Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167GS50

Protein Details
Accession A0A167GS50    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-60VFRFCTSKCNKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-58KMKRNPRKVRWTKAFRKA
Subcellular Location(s) mito 11, mito_nucl 10.833, cyto_nucl 8.666, nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEKCYFCSTNVYPGHGSAFVRNDAKVFRFCTSKCNKNFKMKRNPRKVRWTKAFRKAAGKEMVIDSTFEFEKRRNVPVRYDRELMATTIKAMRRVGEIRQRRERAFFKNRCVLCLWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.28
5 0.27
6 0.22
7 0.22
8 0.22
9 0.23
10 0.22
11 0.21
12 0.22
13 0.24
14 0.24
15 0.24
16 0.22
17 0.26
18 0.26
19 0.34
20 0.4
21 0.46
22 0.51
23 0.58
24 0.62
25 0.69
26 0.77
27 0.77
28 0.81
29 0.83
30 0.85
31 0.86
32 0.89
33 0.87
34 0.89
35 0.89
36 0.87
37 0.87
38 0.86
39 0.84
40 0.84
41 0.83
42 0.74
43 0.73
44 0.65
45 0.61
46 0.54
47 0.45
48 0.36
49 0.3
50 0.28
51 0.19
52 0.18
53 0.11
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.16
60 0.18
61 0.25
62 0.3
63 0.32
64 0.41
65 0.5
66 0.56
67 0.55
68 0.54
69 0.48
70 0.44
71 0.43
72 0.35
73 0.28
74 0.2
75 0.16
76 0.19
77 0.2
78 0.2
79 0.19
80 0.2
81 0.22
82 0.25
83 0.31
84 0.37
85 0.45
86 0.51
87 0.61
88 0.65
89 0.63
90 0.69
91 0.67
92 0.67
93 0.69
94 0.68
95 0.66
96 0.7
97 0.68
98 0.62