Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167RPU1

Protein Details
Accession A0A167RPU1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86GIYDRPRRSSQPRDDRHVRSBasic
NLS Segment(s)
Subcellular Location(s) plas 13, extr 6, mito 3, E.R. 2, vacu 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MLTLAIPAACIPTSSALACVVPLAIPVPCIPQPAFLRAAFLSLVTIGMYDRPRPFLRAAFLGLVTIGIYDRPRRSSQPRDDRHVRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.11
5 0.1
6 0.09
7 0.07
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.06
14 0.09
15 0.1
16 0.12
17 0.12
18 0.18
19 0.19
20 0.21
21 0.24
22 0.21
23 0.22
24 0.2
25 0.21
26 0.14
27 0.13
28 0.1
29 0.06
30 0.07
31 0.04
32 0.04
33 0.03
34 0.06
35 0.07
36 0.1
37 0.11
38 0.15
39 0.16
40 0.19
41 0.21
42 0.21
43 0.23
44 0.22
45 0.23
46 0.19
47 0.19
48 0.16
49 0.14
50 0.11
51 0.08
52 0.06
53 0.05
54 0.05
55 0.07
56 0.13
57 0.16
58 0.21
59 0.25
60 0.32
61 0.41
62 0.5
63 0.59
64 0.65
65 0.7
66 0.75
67 0.8