Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167QEB3

Protein Details
Accession A0A167QEB3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTRGNQRERDREKAQKKQVAKKPKEBasic
NLS Segment(s)
PositionSequence
9-54RDREKAQKKQVAKKPKESNTSLQQRRERDAEAMRIKKEAKEKGTTA
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
IPR040211  SERF1/2  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGNQRERDREKAQKKQVAKKPKESNTSLQQRRERDAEAMRIKKEAKEKGTTAAPGAAAGGGGGGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.8
4 0.82
5 0.82
6 0.83
7 0.79
8 0.79
9 0.79
10 0.79
11 0.78
12 0.72
13 0.7
14 0.68
15 0.72
16 0.67
17 0.65
18 0.63
19 0.59
20 0.58
21 0.53
22 0.44
23 0.38
24 0.35
25 0.36
26 0.38
27 0.39
28 0.36
29 0.37
30 0.37
31 0.37
32 0.42
33 0.4
34 0.37
35 0.39
36 0.4
37 0.41
38 0.44
39 0.41
40 0.35
41 0.29
42 0.24
43 0.18
44 0.17
45 0.12
46 0.08
47 0.07
48 0.05