Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167PV32

Protein Details
Accession A0A167PV32    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-47KVKQQTPKVDKQEKKKKPKGRAKKRMLYNRRFVNVBasic
NLS Segment(s)
PositionSequence
13-39KVKQQTPKVDKQEKKKKPKGRAKKRML
Subcellular Location(s) nucl 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKQQTPKVDKQEKKKKPKGRAKKRMLYNRRFVNVTAAPGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.49
4 0.53
5 0.58
6 0.66
7 0.69
8 0.72
9 0.73
10 0.76
11 0.79
12 0.8
13 0.83
14 0.84
15 0.82
16 0.83
17 0.88
18 0.88
19 0.89
20 0.9
21 0.89
22 0.88
23 0.9
24 0.9
25 0.9
26 0.87
27 0.84
28 0.82
29 0.75
30 0.68
31 0.59
32 0.56
33 0.48
34 0.42
35 0.37
36 0.31
37 0.29