Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2WT41

Protein Details
Accession G2WT41    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MVKPLSFKGDKKPKKRKRPATEGDGPDABasic
NLS Segment(s)
PositionSequence
8-19KGDKKPKKRKRP
213-257ARFKPRLKASKEEKAKERISRKELEAAVGRKLEEDEVRRLKRARR
Subcellular Location(s) mito 10.5, nucl 10, cyto_mito 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
KEGG vda:VDAG_00964  -  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLSFKGDKKPKKRKRPATEGDGPDAESSSLVPASASASASASVTAAENPDSDDSWVSADTTADVVGPVMFVLPTDPPSALATDAVGKVFCLELENMVDGNPATAEPHDVRQVWVANKVSGTEQFRFKGHHGKYLGCDKNGTLSAASDAVSPLECFHILPTADTPGTFQLQTLRDTFVTATPSTGSKAAHEVRGDADAVSFASTLRIRMQARFKPRLKASKEEKAKERISRKELEAAVGRKLEEDEVRRLKRARREGDYHEQLLMFKVKSKHDKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.94
3 0.94
4 0.94
5 0.95
6 0.93
7 0.92
8 0.91
9 0.84
10 0.79
11 0.69
12 0.59
13 0.48
14 0.39
15 0.29
16 0.19
17 0.14
18 0.1
19 0.09
20 0.08
21 0.07
22 0.06
23 0.08
24 0.09
25 0.09
26 0.08
27 0.08
28 0.09
29 0.09
30 0.09
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.11
46 0.1
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.04
62 0.05
63 0.07
64 0.08
65 0.08
66 0.09
67 0.1
68 0.11
69 0.1
70 0.1
71 0.08
72 0.1
73 0.1
74 0.09
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.06
89 0.06
90 0.05
91 0.04
92 0.04
93 0.04
94 0.07
95 0.08
96 0.1
97 0.13
98 0.13
99 0.14
100 0.15
101 0.19
102 0.17
103 0.21
104 0.2
105 0.18
106 0.18
107 0.18
108 0.17
109 0.18
110 0.2
111 0.18
112 0.2
113 0.2
114 0.21
115 0.23
116 0.24
117 0.29
118 0.26
119 0.3
120 0.29
121 0.29
122 0.31
123 0.39
124 0.4
125 0.31
126 0.3
127 0.23
128 0.25
129 0.24
130 0.21
131 0.11
132 0.09
133 0.09
134 0.09
135 0.09
136 0.06
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.05
144 0.05
145 0.06
146 0.08
147 0.08
148 0.09
149 0.09
150 0.11
151 0.11
152 0.11
153 0.11
154 0.1
155 0.11
156 0.1
157 0.1
158 0.13
159 0.14
160 0.16
161 0.17
162 0.17
163 0.16
164 0.17
165 0.17
166 0.14
167 0.15
168 0.13
169 0.13
170 0.12
171 0.12
172 0.13
173 0.14
174 0.12
175 0.1
176 0.16
177 0.18
178 0.2
179 0.2
180 0.2
181 0.19
182 0.2
183 0.2
184 0.13
185 0.11
186 0.08
187 0.08
188 0.07
189 0.06
190 0.05
191 0.08
192 0.08
193 0.09
194 0.11
195 0.17
196 0.18
197 0.24
198 0.33
199 0.37
200 0.46
201 0.55
202 0.57
203 0.6
204 0.66
205 0.7
206 0.67
207 0.7
208 0.69
209 0.69
210 0.75
211 0.73
212 0.72
213 0.71
214 0.72
215 0.72
216 0.72
217 0.71
218 0.68
219 0.66
220 0.62
221 0.62
222 0.55
223 0.52
224 0.5
225 0.43
226 0.41
227 0.37
228 0.34
229 0.27
230 0.27
231 0.25
232 0.23
233 0.25
234 0.31
235 0.39
236 0.42
237 0.47
238 0.51
239 0.55
240 0.6
241 0.66
242 0.65
243 0.64
244 0.68
245 0.71
246 0.77
247 0.77
248 0.69
249 0.6
250 0.52
251 0.44
252 0.41
253 0.37
254 0.26
255 0.25
256 0.29
257 0.36
258 0.46