Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167N0M9

Protein Details
Accession A0A167N0M9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-79PCPPRCAKRGHGRNRLPPKLKADRPNRRQQATHydrophilic
NLS Segment(s)
PositionSequence
55-74KRGHGRNRLPPKLKADRPNR
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MWSPSGEKGLDTGCASFFGWRQSESPAPLKFSPSPGPTTTPQLRSYHPCPPRCAKRGHGRNRLPPKLKADRPNRRQQATPAATGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.16
6 0.16
7 0.17
8 0.17
9 0.2
10 0.23
11 0.25
12 0.31
13 0.28
14 0.31
15 0.3
16 0.34
17 0.3
18 0.31
19 0.33
20 0.28
21 0.31
22 0.27
23 0.3
24 0.27
25 0.33
26 0.33
27 0.31
28 0.32
29 0.31
30 0.32
31 0.34
32 0.37
33 0.38
34 0.42
35 0.42
36 0.44
37 0.51
38 0.57
39 0.56
40 0.57
41 0.56
42 0.6
43 0.67
44 0.73
45 0.74
46 0.73
47 0.78
48 0.84
49 0.86
50 0.8
51 0.76
52 0.74
53 0.74
54 0.74
55 0.74
56 0.74
57 0.76
58 0.79
59 0.84
60 0.84
61 0.79
62 0.75
63 0.72
64 0.72
65 0.65
66 0.6