Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167MKU5

Protein Details
Accession A0A167MKU5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-33GICSGWEGRRWRRRRARVGYQKPAKWGHydrophilic
NLS Segment(s)
PositionSequence
15-46RRWRRRRARVGYQKPAKWGREGVGRARARRER
Subcellular Location(s) mito 16, extr 6, nucl 2, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MPALSLGICSGWEGRRWRRRRARVGYQKPAKWGREGVGRARARRERRCCRLTLASCARGDCALVGFCQGFPERGKRSLSSGTNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.44
3 0.5
4 0.6
5 0.67
6 0.76
7 0.81
8 0.84
9 0.85
10 0.86
11 0.91
12 0.91
13 0.89
14 0.8
15 0.77
16 0.75
17 0.65
18 0.56
19 0.48
20 0.4
21 0.39
22 0.38
23 0.34
24 0.37
25 0.38
26 0.37
27 0.42
28 0.46
29 0.47
30 0.54
31 0.61
32 0.61
33 0.67
34 0.7
35 0.65
36 0.64
37 0.65
38 0.58
39 0.58
40 0.55
41 0.5
42 0.47
43 0.46
44 0.4
45 0.3
46 0.28
47 0.18
48 0.13
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.11
55 0.12
56 0.12
57 0.15
58 0.23
59 0.26
60 0.3
61 0.34
62 0.33
63 0.38
64 0.44