Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167NV41

Protein Details
Accession A0A167NV41   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
332-355AQKAKAPPTNRWGRRKEKSSSMMSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031355  DUF5102  
Pfam View protein in Pfam  
PF17104  DUF5102  
Amino Acid Sequences MEDDPFDASVWSTNPASTSKVEEALPVKEAPSETPTSPAADGDGFDDFDDFGAPAAPAGEGDAADFGDEFGDFGETIESESVTFVQAEQPPPAPPPAPTENLEALVLDPMPSREELERQIDALIAPIFPIDTGQFSDEPIREVNGIGQMLVTKSSRDLYRTLTEIPSDMTRPVNWTRSRIRRQQLIALGVPVNLDEVLPTSSAKPLPTLHITTTPTARPASAPPGRPSTPAGLNSRAATPVPGHRTPRTGTGPPPLGPAPRIDMDKAEEVLRYTESQSSILPLAAVESQLAEIRTVTEQANALLAHLLQSRDVLQQDSETYNTLIAELVGEAQKAKAPPTNRWGRRKEKSSSMMSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.2
4 0.19
5 0.24
6 0.23
7 0.25
8 0.25
9 0.27
10 0.29
11 0.28
12 0.29
13 0.23
14 0.21
15 0.21
16 0.22
17 0.19
18 0.22
19 0.23
20 0.21
21 0.24
22 0.25
23 0.25
24 0.24
25 0.22
26 0.18
27 0.15
28 0.15
29 0.13
30 0.13
31 0.11
32 0.1
33 0.11
34 0.09
35 0.08
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.05
63 0.06
64 0.07
65 0.07
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.06
72 0.11
73 0.14
74 0.16
75 0.17
76 0.18
77 0.19
78 0.21
79 0.23
80 0.18
81 0.16
82 0.21
83 0.24
84 0.26
85 0.27
86 0.3
87 0.29
88 0.29
89 0.28
90 0.21
91 0.17
92 0.14
93 0.12
94 0.08
95 0.07
96 0.06
97 0.07
98 0.08
99 0.09
100 0.1
101 0.12
102 0.15
103 0.19
104 0.19
105 0.18
106 0.18
107 0.17
108 0.15
109 0.14
110 0.11
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.05
117 0.04
118 0.05
119 0.06
120 0.08
121 0.08
122 0.09
123 0.12
124 0.12
125 0.13
126 0.12
127 0.12
128 0.11
129 0.11
130 0.11
131 0.1
132 0.1
133 0.08
134 0.08
135 0.08
136 0.07
137 0.09
138 0.08
139 0.06
140 0.07
141 0.09
142 0.1
143 0.12
144 0.13
145 0.16
146 0.18
147 0.19
148 0.2
149 0.19
150 0.18
151 0.16
152 0.16
153 0.13
154 0.12
155 0.11
156 0.1
157 0.09
158 0.13
159 0.16
160 0.22
161 0.22
162 0.26
163 0.33
164 0.42
165 0.49
166 0.53
167 0.56
168 0.55
169 0.55
170 0.56
171 0.52
172 0.45
173 0.39
174 0.32
175 0.27
176 0.2
177 0.18
178 0.12
179 0.09
180 0.05
181 0.05
182 0.03
183 0.04
184 0.05
185 0.05
186 0.06
187 0.06
188 0.08
189 0.09
190 0.09
191 0.1
192 0.1
193 0.14
194 0.17
195 0.18
196 0.18
197 0.21
198 0.23
199 0.23
200 0.25
201 0.21
202 0.2
203 0.19
204 0.18
205 0.14
206 0.15
207 0.22
208 0.24
209 0.28
210 0.28
211 0.34
212 0.35
213 0.35
214 0.35
215 0.31
216 0.3
217 0.31
218 0.32
219 0.29
220 0.3
221 0.29
222 0.28
223 0.24
224 0.2
225 0.16
226 0.15
227 0.18
228 0.23
229 0.27
230 0.3
231 0.31
232 0.35
233 0.35
234 0.41
235 0.4
236 0.37
237 0.36
238 0.39
239 0.41
240 0.37
241 0.4
242 0.34
243 0.29
244 0.27
245 0.25
246 0.22
247 0.21
248 0.22
249 0.19
250 0.19
251 0.21
252 0.22
253 0.22
254 0.19
255 0.17
256 0.16
257 0.17
258 0.16
259 0.14
260 0.14
261 0.16
262 0.16
263 0.16
264 0.15
265 0.16
266 0.16
267 0.14
268 0.12
269 0.09
270 0.09
271 0.09
272 0.09
273 0.06
274 0.06
275 0.07
276 0.08
277 0.09
278 0.08
279 0.07
280 0.09
281 0.1
282 0.12
283 0.11
284 0.12
285 0.12
286 0.12
287 0.14
288 0.12
289 0.12
290 0.11
291 0.1
292 0.1
293 0.12
294 0.13
295 0.1
296 0.12
297 0.13
298 0.16
299 0.17
300 0.16
301 0.15
302 0.16
303 0.19
304 0.2
305 0.19
306 0.18
307 0.17
308 0.16
309 0.15
310 0.14
311 0.11
312 0.09
313 0.08
314 0.06
315 0.08
316 0.08
317 0.09
318 0.09
319 0.09
320 0.13
321 0.14
322 0.16
323 0.2
324 0.23
325 0.31
326 0.41
327 0.51
328 0.57
329 0.67
330 0.73
331 0.78
332 0.85
333 0.85
334 0.83
335 0.82
336 0.8