Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167IQW9

Protein Details
Accession A0A167IQW9   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
477-504EPALRTPSPAPRRRKRRSQSPAGKRASPHydrophilic
NLS Segment(s)
PositionSequence
485-523PAPRRRKRRSQSPAGKRASPGPGGKAKGRRGPAVFPRKS
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021622  Afadin/alpha-actinin-bd  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF11559  ADIP  
Amino Acid Sequences MATVPPTPGRVRFVSPAASSPASTSTASAASHSTAASSEPDLTSSLAFLTTQLQSHGFLPPSSLLSQSHSLARLPTAEQQELQRCLMQLLQQRVEDMRRLEEVGGELRTREWESGRWKSLCAEEREGRERAEREVEQGRARLAALAKQHSTEQAAHKQTASHLTRAQSALQTTRAHAQAELRKREKEVERMGERWARVAGEQARLGALGSGLRMSAPLSASTVSVPTDPLLESQLQETEEARARLVEENDALRSALLSAANGLQSLLTPGAAPMLASTLFTPGMVILGEGADWQASNARGKLLELCGKLRERLSAGPLQAGAEGSVADAGELAIARDEIDRLAGNVRRLEEELAELRGREERGQRLMEQYAMQATRGRVSDAVLDRDTPPDKRAALQEQTRAVEQERAQMTAAAVELGRERAELQRQRAQLDDERRKAALRALLDDLPATPTVHLPSSTPAAVIRVSLDDGEDAFAEPALRTPSPAPRRRKRRSQSPAGKRASPGPGGKAKGRRGPAVFPRKSAMRAAADYRPAVGSPLKTMMTFAASSSSVGSGSDPRLSVAGHVGKGKQKENAPPIDVTPLPALSLKASRESTALRTARDSVGLRGADSMRLSASHLVGGARRKSVLGGGAQRVWRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.38
4 0.38
5 0.36
6 0.31
7 0.28
8 0.27
9 0.24
10 0.23
11 0.2
12 0.17
13 0.18
14 0.17
15 0.17
16 0.16
17 0.14
18 0.15
19 0.14
20 0.13
21 0.11
22 0.12
23 0.13
24 0.13
25 0.14
26 0.13
27 0.14
28 0.15
29 0.15
30 0.14
31 0.12
32 0.11
33 0.09
34 0.09
35 0.08
36 0.11
37 0.12
38 0.13
39 0.14
40 0.15
41 0.16
42 0.17
43 0.21
44 0.19
45 0.17
46 0.19
47 0.19
48 0.21
49 0.2
50 0.21
51 0.17
52 0.21
53 0.24
54 0.23
55 0.25
56 0.23
57 0.23
58 0.22
59 0.23
60 0.2
61 0.2
62 0.25
63 0.27
64 0.27
65 0.28
66 0.33
67 0.39
68 0.4
69 0.39
70 0.35
71 0.3
72 0.29
73 0.29
74 0.28
75 0.28
76 0.32
77 0.34
78 0.32
79 0.34
80 0.36
81 0.36
82 0.35
83 0.3
84 0.26
85 0.23
86 0.25
87 0.23
88 0.21
89 0.21
90 0.19
91 0.19
92 0.17
93 0.15
94 0.15
95 0.18
96 0.18
97 0.18
98 0.17
99 0.21
100 0.29
101 0.37
102 0.44
103 0.41
104 0.41
105 0.41
106 0.48
107 0.48
108 0.46
109 0.46
110 0.44
111 0.5
112 0.54
113 0.53
114 0.46
115 0.45
116 0.41
117 0.37
118 0.38
119 0.32
120 0.32
121 0.36
122 0.38
123 0.35
124 0.35
125 0.32
126 0.25
127 0.25
128 0.23
129 0.18
130 0.18
131 0.2
132 0.23
133 0.23
134 0.24
135 0.25
136 0.23
137 0.25
138 0.26
139 0.27
140 0.31
141 0.34
142 0.34
143 0.34
144 0.33
145 0.32
146 0.38
147 0.34
148 0.29
149 0.29
150 0.3
151 0.33
152 0.33
153 0.33
154 0.26
155 0.25
156 0.24
157 0.25
158 0.24
159 0.22
160 0.25
161 0.25
162 0.23
163 0.22
164 0.27
165 0.3
166 0.38
167 0.46
168 0.44
169 0.45
170 0.46
171 0.53
172 0.51
173 0.52
174 0.51
175 0.51
176 0.51
177 0.51
178 0.54
179 0.5
180 0.45
181 0.38
182 0.31
183 0.22
184 0.18
185 0.23
186 0.22
187 0.21
188 0.21
189 0.2
190 0.19
191 0.18
192 0.18
193 0.11
194 0.08
195 0.05
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.06
203 0.06
204 0.06
205 0.07
206 0.08
207 0.08
208 0.08
209 0.09
210 0.08
211 0.07
212 0.08
213 0.07
214 0.07
215 0.07
216 0.08
217 0.09
218 0.09
219 0.09
220 0.09
221 0.11
222 0.1
223 0.1
224 0.1
225 0.11
226 0.14
227 0.14
228 0.13
229 0.12
230 0.13
231 0.15
232 0.16
233 0.14
234 0.12
235 0.13
236 0.13
237 0.13
238 0.12
239 0.09
240 0.08
241 0.07
242 0.07
243 0.06
244 0.05
245 0.05
246 0.06
247 0.06
248 0.06
249 0.06
250 0.04
251 0.04
252 0.05
253 0.05
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.03
261 0.04
262 0.04
263 0.04
264 0.05
265 0.05
266 0.06
267 0.06
268 0.06
269 0.04
270 0.05
271 0.04
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.02
279 0.02
280 0.03
281 0.04
282 0.06
283 0.07
284 0.07
285 0.08
286 0.08
287 0.09
288 0.1
289 0.11
290 0.15
291 0.15
292 0.16
293 0.19
294 0.2
295 0.22
296 0.2
297 0.19
298 0.16
299 0.16
300 0.18
301 0.18
302 0.17
303 0.16
304 0.16
305 0.14
306 0.13
307 0.11
308 0.08
309 0.05
310 0.04
311 0.04
312 0.04
313 0.03
314 0.03
315 0.03
316 0.02
317 0.02
318 0.02
319 0.02
320 0.02
321 0.02
322 0.03
323 0.03
324 0.04
325 0.03
326 0.04
327 0.04
328 0.05
329 0.09
330 0.11
331 0.12
332 0.14
333 0.15
334 0.15
335 0.16
336 0.16
337 0.13
338 0.13
339 0.12
340 0.12
341 0.12
342 0.11
343 0.1
344 0.12
345 0.13
346 0.14
347 0.17
348 0.18
349 0.22
350 0.24
351 0.24
352 0.25
353 0.25
354 0.23
355 0.19
356 0.16
357 0.15
358 0.14
359 0.13
360 0.13
361 0.13
362 0.14
363 0.14
364 0.15
365 0.12
366 0.12
367 0.18
368 0.17
369 0.2
370 0.17
371 0.18
372 0.18
373 0.22
374 0.23
375 0.18
376 0.17
377 0.17
378 0.17
379 0.18
380 0.22
381 0.24
382 0.29
383 0.31
384 0.35
385 0.35
386 0.36
387 0.34
388 0.31
389 0.26
390 0.25
391 0.21
392 0.24
393 0.21
394 0.21
395 0.21
396 0.2
397 0.19
398 0.15
399 0.14
400 0.07
401 0.06
402 0.06
403 0.06
404 0.06
405 0.06
406 0.06
407 0.07
408 0.1
409 0.19
410 0.23
411 0.29
412 0.35
413 0.36
414 0.37
415 0.38
416 0.39
417 0.37
418 0.43
419 0.47
420 0.44
421 0.44
422 0.44
423 0.43
424 0.39
425 0.36
426 0.3
427 0.22
428 0.21
429 0.23
430 0.23
431 0.22
432 0.21
433 0.18
434 0.15
435 0.14
436 0.11
437 0.08
438 0.09
439 0.1
440 0.11
441 0.11
442 0.11
443 0.12
444 0.15
445 0.14
446 0.14
447 0.12
448 0.13
449 0.12
450 0.12
451 0.1
452 0.08
453 0.09
454 0.08
455 0.08
456 0.07
457 0.07
458 0.08
459 0.07
460 0.07
461 0.06
462 0.06
463 0.06
464 0.06
465 0.08
466 0.11
467 0.11
468 0.12
469 0.14
470 0.24
471 0.34
472 0.43
473 0.51
474 0.58
475 0.7
476 0.78
477 0.86
478 0.86
479 0.87
480 0.89
481 0.9
482 0.91
483 0.91
484 0.92
485 0.86
486 0.79
487 0.69
488 0.65
489 0.59
490 0.54
491 0.45
492 0.41
493 0.42
494 0.42
495 0.47
496 0.49
497 0.51
498 0.52
499 0.53
500 0.54
501 0.5
502 0.55
503 0.59
504 0.62
505 0.58
506 0.53
507 0.54
508 0.5
509 0.49
510 0.44
511 0.4
512 0.34
513 0.35
514 0.37
515 0.38
516 0.38
517 0.35
518 0.33
519 0.28
520 0.23
521 0.22
522 0.21
523 0.17
524 0.16
525 0.2
526 0.19
527 0.18
528 0.19
529 0.18
530 0.18
531 0.17
532 0.14
533 0.13
534 0.13
535 0.13
536 0.13
537 0.13
538 0.1
539 0.1
540 0.11
541 0.12
542 0.14
543 0.16
544 0.15
545 0.15
546 0.16
547 0.16
548 0.16
549 0.2
550 0.22
551 0.21
552 0.24
553 0.27
554 0.32
555 0.37
556 0.4
557 0.39
558 0.4
559 0.47
560 0.53
561 0.55
562 0.53
563 0.5
564 0.48
565 0.47
566 0.42
567 0.35
568 0.29
569 0.22
570 0.2
571 0.2
572 0.19
573 0.16
574 0.2
575 0.19
576 0.23
577 0.25
578 0.24
579 0.26
580 0.28
581 0.3
582 0.35
583 0.36
584 0.32
585 0.34
586 0.36
587 0.35
588 0.37
589 0.35
590 0.28
591 0.33
592 0.31
593 0.28
594 0.29
595 0.28
596 0.26
597 0.24
598 0.22
599 0.16
600 0.16
601 0.18
602 0.18
603 0.17
604 0.15
605 0.15
606 0.16
607 0.19
608 0.27
609 0.28
610 0.27
611 0.27
612 0.27
613 0.27
614 0.28
615 0.28
616 0.28
617 0.31
618 0.34
619 0.39