Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167GCI9

Protein Details
Accession A0A167GCI9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-75VADLKKRGKGAPKKKKEKGQLRBasic
NLS Segment(s)
PositionSequence
58-75KKRGKGAPKKKKEKGQLR
Subcellular Location(s) mito 17, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences PSSASTGPKYLRARLRGPAMVRYYPQRIPIQLVRAVAWNMNIVDSREVQRVHDVADLKKRGKGAPKKKKEKGQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.52
4 0.5
5 0.5
6 0.47
7 0.43
8 0.41
9 0.4
10 0.38
11 0.35
12 0.37
13 0.32
14 0.29
15 0.32
16 0.33
17 0.32
18 0.3
19 0.28
20 0.23
21 0.23
22 0.22
23 0.17
24 0.14
25 0.11
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.12
33 0.14
34 0.15
35 0.15
36 0.18
37 0.17
38 0.18
39 0.2
40 0.2
41 0.21
42 0.29
43 0.34
44 0.32
45 0.34
46 0.35
47 0.35
48 0.43
49 0.5
50 0.53
51 0.59
52 0.69
53 0.78
54 0.85
55 0.91