Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167SBD2

Protein Details
Accession A0A167SBD2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LYVKGRVLGHKRAKRNSRPNTSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MASSRLYVKGRVLGHKRAKRNSRPNTSLLQIEGLTNKEDAQFYLGKRVAYVYKAQKEVHGSRVRVIWGRVTRPHGNSGVVKGKFRSNLPPRAFGASIRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.69
4 0.73
5 0.79
6 0.8
7 0.85
8 0.85
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.35
17 0.25
18 0.21
19 0.19
20 0.15
21 0.13
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.11
28 0.13
29 0.12
30 0.19
31 0.2
32 0.19
33 0.19
34 0.2
35 0.18
36 0.17
37 0.23
38 0.22
39 0.25
40 0.28
41 0.28
42 0.28
43 0.33
44 0.34
45 0.37
46 0.36
47 0.32
48 0.31
49 0.33
50 0.32
51 0.28
52 0.27
53 0.25
54 0.23
55 0.27
56 0.29
57 0.34
58 0.38
59 0.38
60 0.41
61 0.36
62 0.36
63 0.33
64 0.35
65 0.37
66 0.33
67 0.33
68 0.31
69 0.34
70 0.34
71 0.35
72 0.4
73 0.39
74 0.47
75 0.5
76 0.53
77 0.51
78 0.53
79 0.52
80 0.42
81 0.4
82 0.33
83 0.31
84 0.27
85 0.25
86 0.2