Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167PU10

Protein Details
Accession A0A167PU10   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
43-70PAGRASKGKGKGRKDTKKEKGGKERGTMBasic
99-119RSSDARPRKHKQPKPGDVRWPBasic
NLS Segment(s)
PositionSequence
45-67GRASKGKGKGRKDTKKEKGGKER
107-107K
278-285PRKKRKKR
Subcellular Location(s) nucl 10, cyto_nucl 9, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MPTKQKRSPYVPAALRTELAEYTNLLRSLHVENVQDLARHVLPAGRASKGKGKGRKDTKKEKGGKERGTMTEEEELDLPSEAEGSELDNFLPSDTDDDRSSDARPRKHKQPKPGDVRWPLMAEDVYVPEWTLADEVAVIAGQVLAQSSSPSAAVEEGADPDPLSPAYNDTLTSSASLLLCQLLVLLSSNRPKLAKSLQNRFRPLGWEEVLEVAAASGALEAEVLERARGRMDVDGEEGVRAVERRKIVEASERRLREVWDLYEQDLFDVPELPDSEPPRKKRKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.53
3 0.44
4 0.39
5 0.29
6 0.24
7 0.19
8 0.15
9 0.16
10 0.2
11 0.2
12 0.18
13 0.17
14 0.19
15 0.21
16 0.25
17 0.26
18 0.22
19 0.22
20 0.24
21 0.25
22 0.23
23 0.2
24 0.2
25 0.16
26 0.15
27 0.15
28 0.14
29 0.14
30 0.2
31 0.21
32 0.2
33 0.21
34 0.24
35 0.32
36 0.38
37 0.46
38 0.49
39 0.54
40 0.61
41 0.71
42 0.78
43 0.8
44 0.83
45 0.84
46 0.86
47 0.88
48 0.88
49 0.88
50 0.87
51 0.84
52 0.79
53 0.74
54 0.67
55 0.61
56 0.52
57 0.44
58 0.39
59 0.32
60 0.27
61 0.22
62 0.19
63 0.16
64 0.15
65 0.12
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.08
81 0.09
82 0.12
83 0.12
84 0.13
85 0.15
86 0.16
87 0.17
88 0.21
89 0.26
90 0.31
91 0.39
92 0.44
93 0.53
94 0.63
95 0.67
96 0.71
97 0.76
98 0.79
99 0.8
100 0.81
101 0.79
102 0.73
103 0.7
104 0.61
105 0.51
106 0.41
107 0.33
108 0.26
109 0.17
110 0.12
111 0.1
112 0.09
113 0.08
114 0.07
115 0.06
116 0.06
117 0.05
118 0.05
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.06
144 0.06
145 0.07
146 0.06
147 0.06
148 0.07
149 0.06
150 0.07
151 0.05
152 0.06
153 0.07
154 0.08
155 0.08
156 0.09
157 0.09
158 0.09
159 0.1
160 0.08
161 0.09
162 0.08
163 0.08
164 0.07
165 0.06
166 0.06
167 0.05
168 0.05
169 0.03
170 0.03
171 0.04
172 0.05
173 0.08
174 0.12
175 0.13
176 0.15
177 0.16
178 0.16
179 0.2
180 0.27
181 0.32
182 0.37
183 0.47
184 0.55
185 0.63
186 0.66
187 0.63
188 0.57
189 0.52
190 0.46
191 0.42
192 0.34
193 0.26
194 0.23
195 0.22
196 0.2
197 0.16
198 0.13
199 0.07
200 0.05
201 0.04
202 0.04
203 0.03
204 0.02
205 0.02
206 0.02
207 0.03
208 0.03
209 0.05
210 0.05
211 0.06
212 0.07
213 0.07
214 0.08
215 0.09
216 0.1
217 0.11
218 0.14
219 0.15
220 0.16
221 0.17
222 0.17
223 0.16
224 0.15
225 0.12
226 0.11
227 0.1
228 0.1
229 0.14
230 0.16
231 0.18
232 0.21
233 0.23
234 0.24
235 0.34
236 0.39
237 0.42
238 0.49
239 0.48
240 0.48
241 0.48
242 0.47
243 0.43
244 0.41
245 0.37
246 0.36
247 0.37
248 0.35
249 0.36
250 0.34
251 0.29
252 0.25
253 0.22
254 0.14
255 0.15
256 0.13
257 0.15
258 0.17
259 0.17
260 0.22
261 0.27
262 0.36
263 0.42
264 0.5
265 0.57