Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167NSZ3

Protein Details
Accession A0A167NSZ3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSRASQPELKKVRRFRKQDKAKSPDEGHydrophilic
NLS Segment(s)
PositionSequence
12-17VRRFRK
Subcellular Location(s) nucl 14, mito 6, cyto 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044641  Lsm7/SmG-like  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034098  Sm_G  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01719  Sm_G  
Amino Acid Sequences MSRASQPELKKVRRFRKQDKAKSPDEGFPFQFMDKRLFVQLQGGRKVSGILRGYDIFLNLVIDDAIEETRPAEKKQIGQVVIRGNSVTSMESLEATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.86
4 0.88
5 0.9
6 0.9
7 0.87
8 0.82
9 0.8
10 0.73
11 0.68
12 0.62
13 0.55
14 0.45
15 0.4
16 0.37
17 0.29
18 0.28
19 0.23
20 0.22
21 0.18
22 0.19
23 0.19
24 0.17
25 0.17
26 0.21
27 0.23
28 0.24
29 0.27
30 0.26
31 0.24
32 0.24
33 0.24
34 0.18
35 0.2
36 0.16
37 0.14
38 0.15
39 0.15
40 0.16
41 0.15
42 0.15
43 0.09
44 0.08
45 0.07
46 0.05
47 0.05
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.09
57 0.11
58 0.12
59 0.17
60 0.2
61 0.24
62 0.32
63 0.38
64 0.36
65 0.36
66 0.4
67 0.42
68 0.41
69 0.37
70 0.3
71 0.23
72 0.22
73 0.21
74 0.17
75 0.1
76 0.1
77 0.1