Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167JWH4

Protein Details
Accession A0A167JWH4   
Localization Confidence High
Confidence Score 21.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSTRSRSASPRPSKRRRTSRSPTPSDAAHydrophilic
204-223RERMLEKKRERREGDRQFRDBasic
254-273AARARFEDKKRTAQREKEAEHydrophilic
NLS Segment(s)
PositionSequence
10-17PRPSKRRR
181-217QARKAGKKEAKERLEEVAPREVGRERMLEKKRERREG
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MSTRSRSASPRPSKRRRTSRSPTPSDAADLPHDAKEITADDYFAKNDEFRAWLRDEKHKYFDELSGEKARSYFRKFVRAWNRGKLPRSLYAGINPTSTASAAQTSFKWGFAQNSNRAEREALERARGEVGSLTWGGSSGDRETRVQGPERPRVAGPSMPSASDLRLAQESAAEAVERERLQARKAGKKEAKERLEEVAPREVGRERMLEKKRERREGDRQFRDGKGDDAAGLEVDEKSLLGGDSFQERIRQRDAARARFEDKKRTAQREKEAEMYERTSARRAKESETMDMFKRMAKERFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.92
4 0.92
5 0.91
6 0.91
7 0.91
8 0.88
9 0.83
10 0.76
11 0.69
12 0.62
13 0.53
14 0.45
15 0.37
16 0.33
17 0.28
18 0.25
19 0.24
20 0.2
21 0.18
22 0.17
23 0.15
24 0.14
25 0.13
26 0.13
27 0.14
28 0.16
29 0.16
30 0.16
31 0.15
32 0.13
33 0.14
34 0.15
35 0.16
36 0.15
37 0.19
38 0.22
39 0.26
40 0.3
41 0.39
42 0.45
43 0.47
44 0.52
45 0.49
46 0.5
47 0.47
48 0.46
49 0.43
50 0.36
51 0.36
52 0.36
53 0.35
54 0.31
55 0.3
56 0.3
57 0.3
58 0.35
59 0.38
60 0.35
61 0.45
62 0.46
63 0.55
64 0.61
65 0.64
66 0.64
67 0.65
68 0.7
69 0.67
70 0.69
71 0.65
72 0.58
73 0.55
74 0.55
75 0.49
76 0.41
77 0.39
78 0.4
79 0.34
80 0.3
81 0.24
82 0.19
83 0.17
84 0.16
85 0.11
86 0.08
87 0.09
88 0.09
89 0.1
90 0.1
91 0.15
92 0.15
93 0.15
94 0.16
95 0.15
96 0.18
97 0.23
98 0.3
99 0.32
100 0.38
101 0.4
102 0.39
103 0.38
104 0.35
105 0.3
106 0.29
107 0.28
108 0.23
109 0.23
110 0.23
111 0.23
112 0.23
113 0.22
114 0.16
115 0.1
116 0.09
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.09
127 0.1
128 0.1
129 0.13
130 0.15
131 0.17
132 0.19
133 0.23
134 0.27
135 0.33
136 0.33
137 0.33
138 0.3
139 0.3
140 0.29
141 0.26
142 0.21
143 0.19
144 0.18
145 0.17
146 0.18
147 0.17
148 0.15
149 0.15
150 0.14
151 0.1
152 0.1
153 0.1
154 0.09
155 0.08
156 0.08
157 0.06
158 0.06
159 0.05
160 0.04
161 0.05
162 0.08
163 0.07
164 0.09
165 0.12
166 0.13
167 0.14
168 0.19
169 0.24
170 0.3
171 0.32
172 0.42
173 0.42
174 0.49
175 0.57
176 0.62
177 0.61
178 0.55
179 0.55
180 0.48
181 0.48
182 0.43
183 0.37
184 0.32
185 0.29
186 0.25
187 0.25
188 0.23
189 0.21
190 0.2
191 0.2
192 0.17
193 0.26
194 0.32
195 0.39
196 0.47
197 0.55
198 0.62
199 0.69
200 0.72
201 0.71
202 0.76
203 0.79
204 0.81
205 0.78
206 0.75
207 0.7
208 0.66
209 0.62
210 0.52
211 0.42
212 0.33
213 0.26
214 0.2
215 0.16
216 0.15
217 0.1
218 0.09
219 0.08
220 0.06
221 0.06
222 0.06
223 0.05
224 0.04
225 0.05
226 0.05
227 0.04
228 0.05
229 0.06
230 0.09
231 0.1
232 0.11
233 0.18
234 0.2
235 0.24
236 0.27
237 0.32
238 0.3
239 0.39
240 0.47
241 0.49
242 0.53
243 0.54
244 0.55
245 0.59
246 0.63
247 0.63
248 0.6
249 0.63
250 0.66
251 0.72
252 0.76
253 0.76
254 0.81
255 0.8
256 0.78
257 0.75
258 0.69
259 0.63
260 0.57
261 0.51
262 0.45
263 0.39
264 0.37
265 0.36
266 0.37
267 0.37
268 0.42
269 0.42
270 0.43
271 0.48
272 0.51
273 0.52
274 0.54
275 0.53
276 0.47
277 0.48
278 0.43
279 0.38
280 0.39
281 0.39