Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167MSV8

Protein Details
Accession A0A167MSV8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRSAKSHKRVKKSKPSTSSYPAHydrophilic
NLS Segment(s)
PositionSequence
5-55AKSHKRVKKSKPSTSSYPAPKPTPAGAPPVPPPVKKRAAGSGLKAKAKASS
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGRSAKSHKRVKKSKPSTSSYPAPKPTPAGAPPVPPPVKKRAAGSGLKAKAKASSGGTKGGPLLGGADYVTLALGGRRRAQQEAEKLAQVSGDGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.82
5 0.79
6 0.77
7 0.74
8 0.71
9 0.66
10 0.6
11 0.55
12 0.5
13 0.45
14 0.42
15 0.34
16 0.33
17 0.29
18 0.29
19 0.3
20 0.36
21 0.36
22 0.33
23 0.35
24 0.35
25 0.39
26 0.38
27 0.38
28 0.35
29 0.39
30 0.39
31 0.4
32 0.41
33 0.4
34 0.39
35 0.38
36 0.32
37 0.27
38 0.26
39 0.24
40 0.18
41 0.19
42 0.2
43 0.22
44 0.22
45 0.21
46 0.2
47 0.18
48 0.14
49 0.09
50 0.08
51 0.05
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.03
59 0.03
60 0.05
61 0.08
62 0.1
63 0.14
64 0.18
65 0.21
66 0.24
67 0.29
68 0.35
69 0.41
70 0.47
71 0.46
72 0.44
73 0.42
74 0.4
75 0.35
76 0.27