Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167H755

Protein Details
Accession A0A167H755    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-81SLPRKEGKKKVLRARFGRRRTHNBasic
NLS Segment(s)
PositionSequence
62-78RKEGKKKVLRARFGRRR
Subcellular Location(s) cyto 16, cyto_nucl 14, nucl 10
Family & Domain DBs
Amino Acid Sequences MGVGAMGDGAMEGPQPAKLAREGEEVVLQEEEEGIVELELDEEEAEQPKEEEELVQLDSLPRKEGKKKVLRARFGRRRTHNEQLIVRPCGIIVARGTFYGAEVLGSVVVSLSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.09
5 0.11
6 0.13
7 0.15
8 0.19
9 0.2
10 0.2
11 0.22
12 0.2
13 0.19
14 0.17
15 0.14
16 0.1
17 0.09
18 0.07
19 0.05
20 0.05
21 0.04
22 0.03
23 0.03
24 0.03
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.1
48 0.11
49 0.14
50 0.21
51 0.27
52 0.36
53 0.43
54 0.52
55 0.6
56 0.67
57 0.72
58 0.75
59 0.8
60 0.8
61 0.8
62 0.8
63 0.79
64 0.79
65 0.78
66 0.79
67 0.74
68 0.7
69 0.67
70 0.66
71 0.64
72 0.58
73 0.5
74 0.4
75 0.33
76 0.29
77 0.24
78 0.17
79 0.12
80 0.14
81 0.14
82 0.14
83 0.15
84 0.13
85 0.13
86 0.12
87 0.1
88 0.07
89 0.06
90 0.07
91 0.06
92 0.06
93 0.05