Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167P6D4

Protein Details
Accession A0A167P6D4   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-73ADESESPRRSKRRRLNPEPAQEDTHydrophilic
NLS Segment(s)
PositionSequence
57-62RRSKRR
249-263KRAGKGKGKGKGRRA
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
Amino Acid Sequences MDNYDDDDDDDMEEVQLQTDDLTALPPHLREEIDVAFDRAARASSRTAPADESESPRRSKRRRLNPEPAQEDTEGGFMLYAEEGEEPASAGGFLPDEPPEAGGFLPSSSPAAAAKKPSHLPLSSIPLALKLLRLPPDDDDVLSTFREAATGWGEGGGGEEQGVSREDWRAVCAVLIGQREELPEEEEDGEDGEELEEGEEGGFARQEEGEGEEESDLTSSEDWRPEPQAESYSASDAGSTYEEVTTPSKRAGKGKGKGKGRRAPVEELSELTYSDLSSRKKREVREAFELFFEETWQGANGNAQGQGQGKGKGKEKELPPTITRRIGAADVARAAKLLNEKMSPAEIEQMLELFTSTQDGTIGVQEFTKIMIMGNVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.07
6 0.08
7 0.08
8 0.06
9 0.08
10 0.08
11 0.1
12 0.12
13 0.12
14 0.14
15 0.16
16 0.16
17 0.15
18 0.19
19 0.19
20 0.22
21 0.22
22 0.21
23 0.2
24 0.2
25 0.2
26 0.16
27 0.16
28 0.13
29 0.14
30 0.17
31 0.21
32 0.26
33 0.28
34 0.29
35 0.29
36 0.3
37 0.32
38 0.32
39 0.34
40 0.37
41 0.39
42 0.42
43 0.47
44 0.56
45 0.58
46 0.66
47 0.7
48 0.72
49 0.79
50 0.86
51 0.89
52 0.89
53 0.91
54 0.86
55 0.79
56 0.71
57 0.6
58 0.51
59 0.41
60 0.31
61 0.2
62 0.14
63 0.11
64 0.07
65 0.07
66 0.05
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.06
83 0.08
84 0.08
85 0.09
86 0.08
87 0.09
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.07
95 0.06
96 0.07
97 0.08
98 0.11
99 0.13
100 0.18
101 0.2
102 0.24
103 0.26
104 0.29
105 0.31
106 0.28
107 0.3
108 0.28
109 0.34
110 0.3
111 0.29
112 0.25
113 0.22
114 0.23
115 0.19
116 0.16
117 0.1
118 0.13
119 0.16
120 0.17
121 0.18
122 0.18
123 0.22
124 0.22
125 0.2
126 0.18
127 0.16
128 0.15
129 0.14
130 0.12
131 0.08
132 0.08
133 0.08
134 0.06
135 0.06
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.07
143 0.06
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.06
150 0.05
151 0.06
152 0.07
153 0.08
154 0.09
155 0.1
156 0.09
157 0.08
158 0.08
159 0.07
160 0.07
161 0.09
162 0.1
163 0.09
164 0.09
165 0.09
166 0.1
167 0.1
168 0.1
169 0.08
170 0.07
171 0.08
172 0.08
173 0.08
174 0.08
175 0.07
176 0.07
177 0.05
178 0.05
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.06
196 0.07
197 0.07
198 0.08
199 0.07
200 0.07
201 0.07
202 0.07
203 0.05
204 0.04
205 0.04
206 0.06
207 0.07
208 0.09
209 0.1
210 0.11
211 0.13
212 0.14
213 0.16
214 0.16
215 0.16
216 0.17
217 0.19
218 0.18
219 0.17
220 0.17
221 0.15
222 0.13
223 0.11
224 0.1
225 0.08
226 0.07
227 0.07
228 0.06
229 0.07
230 0.08
231 0.11
232 0.12
233 0.12
234 0.16
235 0.19
236 0.22
237 0.27
238 0.35
239 0.42
240 0.49
241 0.56
242 0.6
243 0.66
244 0.72
245 0.76
246 0.74
247 0.72
248 0.72
249 0.68
250 0.66
251 0.61
252 0.58
253 0.49
254 0.43
255 0.38
256 0.29
257 0.25
258 0.19
259 0.15
260 0.1
261 0.11
262 0.15
263 0.17
264 0.25
265 0.29
266 0.38
267 0.43
268 0.47
269 0.56
270 0.61
271 0.64
272 0.65
273 0.65
274 0.57
275 0.53
276 0.5
277 0.39
278 0.3
279 0.23
280 0.14
281 0.1
282 0.09
283 0.09
284 0.08
285 0.07
286 0.09
287 0.09
288 0.1
289 0.11
290 0.1
291 0.12
292 0.14
293 0.18
294 0.19
295 0.24
296 0.28
297 0.32
298 0.39
299 0.42
300 0.44
301 0.48
302 0.5
303 0.55
304 0.56
305 0.57
306 0.54
307 0.57
308 0.58
309 0.55
310 0.5
311 0.41
312 0.38
313 0.33
314 0.32
315 0.26
316 0.23
317 0.22
318 0.23
319 0.21
320 0.19
321 0.18
322 0.17
323 0.2
324 0.21
325 0.22
326 0.21
327 0.23
328 0.24
329 0.26
330 0.25
331 0.2
332 0.22
333 0.18
334 0.18
335 0.17
336 0.16
337 0.14
338 0.13
339 0.12
340 0.07
341 0.07
342 0.08
343 0.08
344 0.08
345 0.08
346 0.08
347 0.09
348 0.13
349 0.14
350 0.12
351 0.13
352 0.13
353 0.13
354 0.13
355 0.13
356 0.09
357 0.08