Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167QRV5

Protein Details
Accession A0A167QRV5    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
101-125DATARTEKQKKKDTHFGKRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
85-120LRVKKTRAIRKRLSHADATARTEKQKKKDTHFGKRK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MASNKIKAYELRSKGKADLQKQLTELRSELGTLRVQKIAGGSAAKLTKINTVRKSIARVLTITNQKARQNIREFYKDKKHLPLDLRVKKTRAIRKRLSHADATARTEKQKKKDTHFGKRKYAVKALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.56
4 0.51
5 0.53
6 0.49
7 0.49
8 0.48
9 0.51
10 0.45
11 0.39
12 0.34
13 0.26
14 0.22
15 0.19
16 0.18
17 0.15
18 0.17
19 0.17
20 0.19
21 0.18
22 0.18
23 0.18
24 0.18
25 0.15
26 0.14
27 0.11
28 0.09
29 0.12
30 0.13
31 0.13
32 0.13
33 0.12
34 0.17
35 0.22
36 0.29
37 0.29
38 0.33
39 0.36
40 0.37
41 0.41
42 0.39
43 0.36
44 0.3
45 0.27
46 0.25
47 0.28
48 0.31
49 0.28
50 0.28
51 0.28
52 0.29
53 0.33
54 0.33
55 0.35
56 0.35
57 0.38
58 0.4
59 0.44
60 0.44
61 0.47
62 0.54
63 0.52
64 0.5
65 0.53
66 0.51
67 0.49
68 0.51
69 0.54
70 0.55
71 0.58
72 0.62
73 0.58
74 0.57
75 0.56
76 0.61
77 0.61
78 0.6
79 0.61
80 0.63
81 0.67
82 0.76
83 0.79
84 0.75
85 0.69
86 0.63
87 0.62
88 0.56
89 0.54
90 0.5
91 0.44
92 0.45
93 0.5
94 0.54
95 0.54
96 0.61
97 0.63
98 0.66
99 0.74
100 0.78
101 0.81
102 0.84
103 0.84
104 0.84
105 0.85
106 0.83
107 0.8