Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167RTN6

Protein Details
Accession A0A167RTN6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-143QAPPRRRDRSPDRDRNPHDRRTBasic
NLS Segment(s)
PositionSequence
110-149RRGVRTRERGETQAPPRRRDRSPDRDRNPHDRRTLPRDPR
165-197RKEPERDRRRWEANAERDRPGRREGERWERGRA
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 9.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MYNGPIRGGTRGGAAEFKWTDVATDKDRENYLGHSVNAPAGRWQKNKDIHWYSRDIEGTEEEKREEIRKVKEAEEDALAIALYVNSRLQRRGANTSHQRVPARCPRSADRRGVRTRERGETQAPPRRRDRSPDRDRNPHDRRTLPRDPRDARDERRTDYDEEEMRKEPERDRRRWEANAERDRPGRREGERWERGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.21
4 0.21
5 0.2
6 0.18
7 0.18
8 0.2
9 0.24
10 0.21
11 0.25
12 0.26
13 0.28
14 0.3
15 0.3
16 0.28
17 0.26
18 0.27
19 0.26
20 0.25
21 0.22
22 0.22
23 0.24
24 0.23
25 0.21
26 0.21
27 0.26
28 0.32
29 0.35
30 0.39
31 0.44
32 0.51
33 0.54
34 0.58
35 0.59
36 0.57
37 0.57
38 0.58
39 0.51
40 0.48
41 0.46
42 0.36
43 0.29
44 0.26
45 0.25
46 0.23
47 0.22
48 0.18
49 0.17
50 0.18
51 0.19
52 0.21
53 0.25
54 0.27
55 0.32
56 0.35
57 0.36
58 0.38
59 0.37
60 0.34
61 0.28
62 0.23
63 0.17
64 0.14
65 0.12
66 0.08
67 0.06
68 0.04
69 0.03
70 0.03
71 0.05
72 0.07
73 0.08
74 0.09
75 0.11
76 0.14
77 0.18
78 0.24
79 0.25
80 0.32
81 0.38
82 0.43
83 0.45
84 0.46
85 0.45
86 0.39
87 0.44
88 0.44
89 0.41
90 0.38
91 0.38
92 0.39
93 0.46
94 0.5
95 0.52
96 0.49
97 0.54
98 0.58
99 0.61
100 0.61
101 0.6
102 0.58
103 0.56
104 0.52
105 0.47
106 0.44
107 0.46
108 0.5
109 0.51
110 0.51
111 0.5
112 0.54
113 0.57
114 0.56
115 0.57
116 0.58
117 0.6
118 0.66
119 0.72
120 0.73
121 0.78
122 0.82
123 0.84
124 0.8
125 0.77
126 0.72
127 0.69
128 0.68
129 0.67
130 0.71
131 0.7
132 0.71
133 0.73
134 0.71
135 0.7
136 0.7
137 0.69
138 0.66
139 0.66
140 0.62
141 0.57
142 0.59
143 0.56
144 0.51
145 0.46
146 0.46
147 0.41
148 0.41
149 0.4
150 0.36
151 0.35
152 0.37
153 0.36
154 0.36
155 0.42
156 0.48
157 0.51
158 0.57
159 0.64
160 0.67
161 0.7
162 0.73
163 0.72
164 0.74
165 0.77
166 0.73
167 0.7
168 0.69
169 0.69
170 0.63
171 0.58
172 0.55
173 0.49
174 0.53
175 0.56
176 0.61
177 0.65