FuNGI

A0A167LNF1

Protein Details

Accession

A0A167LNF1

Localization Confidence

Medium

Confidence Score

12.8

NoLS Segment(s)

Position	Sequence	Protein Nature
86-116	EELPSPTKSRGKRTPRKKRRSPSPVKYQVAS	Hydrophilic

NLS Segment(s)

Position	Sequence
93-107	KSRGKRTPRKKRRSP

Subcellular Location(s)

mito 13, nucl 12

Family & Domain DBs

InterPro	View protein in InterPro IPR007220 ORC2
Gene Ontology	GO:0005664 C:nuclear origin of replication recognition complex GO:0003688 F:DNA replication origin binding GO:0006260 P:DNA replication
Pfam	View protein in Pfam PF04084 ORC2

Amino Acid Sequences

MARTPHKRTQQAQSGTPTKRARTTRSSVTTAVEADWGEEDAERARALLRSGREEREDEEEDEEMANAEELEEEEEDEEDDSDEDEEELPSPTKSRGKRTPRKKRRSPSPVKYQVASSADAYFFAHSSKHAPKPASAAQKSFSSLPQLSAHQMQEQLSKPHVAGKHTAQLERLRETHRKRFPRWVFELEQGFNLLWYGFGSKLELLDAFAREVCAKRGHVALLHGYLPSISHTSVMASLLSLPFVPTEPAPPPPSSPAALDMLYHALSMSKRPLFILVHSLDTTGFLTTQMRAVLTLLALHPKCHLVATVDKINAPLLFTQRDLFTRKHDPLDYSSAMKDDGEHPPIPPQRGFGFTWQEVTTFENYTAELAPRASALSGGAAGAGGVNGAHLDLTATIHILNSVPDKSKTLFTLLGKMQLESLASPAEDEGAGLPPGAPKHAAALSHLLTQAREAFIATNEVQFRAQLAEFRDHGLVGGAGSGAQEVLWVNVNKSVLQNVLRVLEEDG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.73
2	0.68
3	0.7
4	0.66
5	0.6
6	0.62
7	0.63
8	0.62
9	0.61
10	0.65
11	0.66
12	0.67
13	0.67
14	0.6
15	0.56
16	0.51
17	0.43
18	0.36
19	0.28
20	0.21
21	0.17
22	0.15
23	0.13
24	0.11
25	0.1
26	0.1
27	0.1
28	0.11
29	0.1
30	0.09
31	0.11
32	0.12
33	0.14
34	0.19
35	0.21
36	0.28
37	0.34
38	0.38
39	0.4
40	0.41
41	0.41
42	0.43
43	0.43
44	0.36
45	0.33
46	0.29
47	0.26
48	0.24
49	0.21
50	0.14
51	0.11
52	0.09
53	0.06
54	0.06
55	0.05
56	0.05
57	0.07
58	0.07
59	0.07
60	0.07
61	0.08
62	0.08
63	0.08
64	0.08
65	0.07
66	0.07
67	0.07
68	0.07
69	0.07
70	0.07
71	0.07
72	0.08
73	0.08
74	0.09
75	0.1
76	0.1
77	0.11
78	0.16
79	0.23
80	0.27
81	0.36
82	0.45
83	0.55
84	0.66
85	0.76
86	0.82
87	0.86
88	0.92
89	0.94
90	0.94
91	0.94
92	0.95
93	0.95
94	0.93
95	0.93
96	0.93
97	0.86
98	0.76
99	0.66
100	0.62
101	0.53
102	0.45
103	0.35
104	0.26
105	0.23
106	0.22
107	0.21
108	0.14
109	0.12
110	0.11
111	0.1
112	0.08
113	0.15
114	0.21
115	0.27
116	0.31
117	0.32
118	0.33
119	0.4
120	0.46
121	0.5
122	0.46
123	0.42
124	0.39
125	0.4
126	0.4
127	0.35
128	0.28
129	0.24
130	0.22
131	0.23
132	0.23
133	0.22
134	0.23
135	0.26
136	0.26
137	0.21
138	0.23
139	0.21
140	0.24
141	0.25
142	0.25
143	0.22
144	0.22
145	0.2
146	0.24
147	0.25
148	0.22
149	0.23
150	0.24
151	0.3
152	0.31
153	0.32
154	0.3
155	0.33
156	0.34
157	0.34
158	0.34
159	0.32
160	0.38
161	0.45
162	0.51
163	0.55
164	0.61
165	0.62
166	0.69
167	0.71
168	0.72
169	0.71
170	0.67
171	0.61
172	0.58
173	0.58
174	0.48
175	0.41
176	0.32
177	0.26
178	0.19
179	0.16
180	0.1
181	0.05
182	0.05
183	0.06
184	0.05
185	0.05
186	0.07
187	0.06
188	0.07
189	0.07
190	0.07
191	0.07
192	0.08
193	0.08
194	0.08
195	0.07
196	0.08
197	0.09
198	0.09
199	0.11
200	0.12
201	0.12
202	0.13
203	0.14
204	0.14
205	0.14
206	0.15
207	0.14
208	0.13
209	0.13
210	0.12
211	0.1
212	0.09
213	0.09
214	0.08
215	0.08
216	0.06
217	0.06
218	0.06
219	0.07
220	0.07
221	0.07
222	0.06
223	0.05
224	0.05
225	0.05
226	0.05
227	0.05
228	0.04
229	0.04
230	0.05
231	0.05
232	0.05
233	0.07
234	0.08
235	0.12
236	0.14
237	0.14
238	0.15
239	0.17
240	0.18
241	0.17
242	0.16
243	0.15
244	0.14
245	0.14
246	0.13
247	0.11
248	0.1
249	0.09
250	0.09
251	0.07
252	0.06
253	0.06
254	0.08
255	0.11
256	0.11
257	0.11
258	0.11
259	0.14
260	0.13
261	0.14
262	0.19
263	0.16
264	0.17
265	0.17
266	0.17
267	0.14
268	0.14
269	0.14
270	0.08
271	0.07
272	0.06
273	0.06
274	0.06
275	0.08
276	0.07
277	0.07
278	0.07
279	0.07
280	0.07
281	0.06
282	0.06
283	0.06
284	0.12
285	0.12
286	0.12
287	0.12
288	0.13
289	0.13
290	0.12
291	0.13
292	0.09
293	0.13
294	0.17
295	0.21
296	0.21
297	0.21
298	0.21
299	0.21
300	0.18
301	0.16
302	0.13
303	0.11
304	0.12
305	0.12
306	0.13
307	0.14
308	0.16
309	0.19
310	0.19
311	0.22
312	0.28
313	0.3
314	0.33
315	0.34
316	0.33
317	0.34
318	0.39
319	0.35
320	0.3
321	0.27
322	0.24
323	0.22
324	0.19
325	0.16
326	0.14
327	0.16
328	0.19
329	0.19
330	0.19
331	0.26
332	0.3
333	0.32
334	0.29
335	0.28
336	0.25
337	0.29
338	0.3
339	0.27
340	0.3
341	0.27
342	0.3
343	0.27
344	0.26
345	0.23
346	0.24
347	0.2
348	0.14
349	0.14
350	0.12
351	0.11
352	0.12
353	0.13
354	0.11
355	0.09
356	0.09
357	0.09
358	0.08
359	0.09
360	0.07
361	0.06
362	0.06
363	0.05
364	0.05
365	0.05
366	0.05
367	0.04
368	0.04
369	0.04
370	0.03
371	0.02
372	0.02
373	0.02
374	0.02
375	0.02
376	0.02
377	0.02
378	0.03
379	0.03
380	0.04
381	0.05
382	0.05
383	0.05
384	0.05
385	0.06
386	0.06
387	0.07
388	0.09
389	0.12
390	0.14
391	0.16
392	0.19
393	0.2
394	0.23
395	0.23
396	0.24
397	0.27
398	0.25
399	0.32
400	0.3
401	0.35
402	0.33
403	0.31
404	0.28
405	0.23
406	0.23
407	0.15
408	0.15
409	0.09
410	0.08
411	0.08
412	0.08
413	0.08
414	0.07
415	0.07
416	0.07
417	0.08
418	0.08
419	0.08
420	0.08
421	0.1
422	0.11
423	0.12
424	0.12
425	0.1
426	0.14
427	0.16
428	0.16
429	0.16
430	0.21
431	0.22
432	0.24
433	0.25
434	0.22
435	0.2
436	0.22
437	0.22
438	0.17
439	0.16
440	0.13
441	0.13
442	0.13
443	0.18
444	0.17
445	0.19
446	0.19
447	0.21
448	0.2
449	0.19
450	0.19
451	0.18
452	0.18
453	0.17
454	0.19
455	0.24
456	0.24
457	0.27
458	0.27
459	0.23
460	0.22
461	0.19
462	0.16
463	0.1
464	0.09
465	0.06
466	0.06
467	0.06
468	0.06
469	0.04
470	0.04
471	0.05
472	0.05
473	0.06
474	0.12
475	0.13
476	0.14
477	0.18
478	0.19
479	0.19
480	0.21
481	0.22
482	0.21
483	0.23
484	0.24
485	0.24
486	0.26
487	0.25

A0A167LNF1

3D AlphaFold-predicted Structure Viewer