Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167NAH2

Protein Details
Accession A0A167NAH2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-28LAVRTTLRRRKTSPQETIKHSKDHydrophilic
48-84MTRMSQRQRSVLRKKPSKKMQERPKKLPEEEKQRRRSBasic
103-127SIDEKERRQHKKLHKKRRSIETGVFBasic
NLS Segment(s)
PositionSequence
58-120VLRKKPSKKMQERPKKLPEEEKQRRRSLSAEPVAAAGIPEKRRRGSIDEKERRQHKKLHKKRR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MADLPLAVRTTLRRRKTSPQETIKHSKDPSTTTGSLLARVSHSMSLNMTRMSQRQRSVLRKKPSKKMQERPKKLPEEEKQRRRSLSAEPVAAAGIPEKRRRGSIDEKERRQHKKLHKKRRSIETGVFAGPDGGPGQIGVPVDYENESSPEEGHAQDNTEEEITSPQATRLTPENQAQDAHEPHIEHPPQATYGASGWAPAVVEAQRSAQAQEGGEPRKGGQSQAQAKGAPYGTDWRTADVPGGARTAEKRNSGSGTLNSPGSPVSPRKRTPSLLRRMRGEAKVVSGRLAMDTGKMEQGRLMKEGYVGGEYNPEPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.66
3 0.76
4 0.8
5 0.8
6 0.81
7 0.81
8 0.82
9 0.86
10 0.8
11 0.77
12 0.68
13 0.63
14 0.57
15 0.54
16 0.5
17 0.48
18 0.44
19 0.38
20 0.42
21 0.37
22 0.35
23 0.32
24 0.28
25 0.21
26 0.21
27 0.22
28 0.18
29 0.18
30 0.17
31 0.18
32 0.21
33 0.21
34 0.21
35 0.21
36 0.21
37 0.26
38 0.32
39 0.36
40 0.36
41 0.42
42 0.5
43 0.58
44 0.66
45 0.69
46 0.73
47 0.77
48 0.82
49 0.85
50 0.86
51 0.87
52 0.88
53 0.89
54 0.89
55 0.9
56 0.91
57 0.9
58 0.9
59 0.87
60 0.81
61 0.81
62 0.79
63 0.79
64 0.8
65 0.81
66 0.79
67 0.77
68 0.74
69 0.66
70 0.6
71 0.56
72 0.56
73 0.5
74 0.43
75 0.37
76 0.35
77 0.33
78 0.29
79 0.21
80 0.13
81 0.13
82 0.16
83 0.2
84 0.23
85 0.24
86 0.27
87 0.3
88 0.35
89 0.41
90 0.47
91 0.54
92 0.61
93 0.66
94 0.72
95 0.77
96 0.77
97 0.71
98 0.7
99 0.7
100 0.71
101 0.76
102 0.79
103 0.81
104 0.84
105 0.88
106 0.89
107 0.86
108 0.8
109 0.75
110 0.68
111 0.61
112 0.51
113 0.43
114 0.32
115 0.24
116 0.18
117 0.13
118 0.08
119 0.05
120 0.04
121 0.04
122 0.05
123 0.05
124 0.06
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.07
131 0.06
132 0.07
133 0.08
134 0.07
135 0.07
136 0.08
137 0.09
138 0.09
139 0.09
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.08
154 0.08
155 0.1
156 0.13
157 0.15
158 0.17
159 0.21
160 0.23
161 0.22
162 0.23
163 0.22
164 0.22
165 0.21
166 0.19
167 0.17
168 0.15
169 0.16
170 0.23
171 0.22
172 0.19
173 0.18
174 0.17
175 0.16
176 0.16
177 0.15
178 0.08
179 0.08
180 0.09
181 0.08
182 0.08
183 0.07
184 0.06
185 0.06
186 0.05
187 0.07
188 0.06
189 0.06
190 0.07
191 0.08
192 0.09
193 0.1
194 0.11
195 0.11
196 0.12
197 0.11
198 0.15
199 0.2
200 0.21
201 0.21
202 0.21
203 0.2
204 0.24
205 0.24
206 0.21
207 0.21
208 0.27
209 0.34
210 0.38
211 0.4
212 0.36
213 0.35
214 0.38
215 0.33
216 0.24
217 0.18
218 0.2
219 0.19
220 0.24
221 0.24
222 0.23
223 0.23
224 0.23
225 0.23
226 0.18
227 0.19
228 0.14
229 0.15
230 0.12
231 0.13
232 0.16
233 0.21
234 0.24
235 0.26
236 0.27
237 0.29
238 0.32
239 0.33
240 0.34
241 0.29
242 0.29
243 0.28
244 0.27
245 0.23
246 0.21
247 0.19
248 0.16
249 0.19
250 0.23
251 0.3
252 0.37
253 0.42
254 0.49
255 0.55
256 0.6
257 0.66
258 0.68
259 0.71
260 0.72
261 0.74
262 0.71
263 0.73
264 0.73
265 0.66
266 0.6
267 0.52
268 0.48
269 0.48
270 0.44
271 0.37
272 0.31
273 0.28
274 0.23
275 0.23
276 0.16
277 0.12
278 0.14
279 0.14
280 0.19
281 0.19
282 0.18
283 0.2
284 0.25
285 0.26
286 0.26
287 0.25
288 0.2
289 0.21
290 0.22
291 0.21
292 0.18
293 0.16
294 0.15
295 0.19
296 0.18