Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167K1D7

Protein Details
Accession A0A167K1D7   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-90DERPMPKLPTLPRRRRRRRNPDGTVAPSTHydrophilic
NLS Segment(s)
PositionSequence
72-80LPRRRRRRR
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences MLRHYTMQGAESGLGADYKKRKNVIRVRAEGEQFLLQADTLVDVVNWIEAFQAATNIALDLDERPMPKLPTLPRRRRRRRNPDGTVAPSTAHSVPTGTAAGTNASAGTPPRSAASTSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.13
4 0.2
5 0.25
6 0.3
7 0.35
8 0.41
9 0.5
10 0.59
11 0.64
12 0.66
13 0.67
14 0.67
15 0.67
16 0.63
17 0.53
18 0.45
19 0.36
20 0.26
21 0.2
22 0.15
23 0.09
24 0.08
25 0.07
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.08
52 0.1
53 0.11
54 0.11
55 0.16
56 0.21
57 0.31
58 0.41
59 0.51
60 0.59
61 0.7
62 0.8
63 0.87
64 0.92
65 0.92
66 0.93
67 0.93
68 0.91
69 0.9
70 0.86
71 0.81
72 0.73
73 0.62
74 0.51
75 0.41
76 0.36
77 0.27
78 0.2
79 0.14
80 0.11
81 0.11
82 0.12
83 0.12
84 0.09
85 0.09
86 0.09
87 0.1
88 0.09
89 0.09
90 0.07
91 0.07
92 0.08
93 0.09
94 0.11
95 0.11
96 0.12
97 0.13
98 0.15
99 0.17