Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WU24

Protein Details
Accession G2WU24    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
102-129KSVRHNNLRCRRCSKRHKATQKSGVMEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 2, plas 2, E.R. 2
Family & Domain DBs
KEGG vda:VDAG_01297  -  
Amino Acid Sequences MATLARPTSRVLLRCKPGSRADKAAIAFLIFVLSGAAHAVVAWRTAEGSEIRDIAFYVANFAAAAAEVSVSRAFWGSHCGPALQRGICLQEYWILTDLRQAKSVRHNNLRCRRCSKRHKATQKSGVMEAGGEAEEGCMILMLGNTWAME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.58
4 0.62
5 0.64
6 0.62
7 0.59
8 0.54
9 0.52
10 0.49
11 0.45
12 0.36
13 0.28
14 0.22
15 0.15
16 0.12
17 0.07
18 0.06
19 0.04
20 0.04
21 0.03
22 0.04
23 0.04
24 0.03
25 0.03
26 0.04
27 0.04
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.07
34 0.07
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.09
42 0.1
43 0.07
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.02
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.1
63 0.1
64 0.12
65 0.13
66 0.13
67 0.13
68 0.16
69 0.18
70 0.13
71 0.13
72 0.12
73 0.14
74 0.14
75 0.14
76 0.11
77 0.12
78 0.12
79 0.13
80 0.14
81 0.12
82 0.12
83 0.17
84 0.22
85 0.19
86 0.23
87 0.23
88 0.24
89 0.34
90 0.43
91 0.46
92 0.51
93 0.57
94 0.63
95 0.73
96 0.77
97 0.73
98 0.74
99 0.75
100 0.76
101 0.8
102 0.81
103 0.81
104 0.86
105 0.9
106 0.92
107 0.92
108 0.92
109 0.88
110 0.81
111 0.71
112 0.61
113 0.5
114 0.39
115 0.29
116 0.2
117 0.12
118 0.08
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.05