Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167IHK3

Protein Details
Accession A0A167IHK3    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTLNQVRRRLRKKREIAKPQSPQLMNHydrophilic
38-57FSEVKPKKPNSAKRKVARVKHydrophilic
NLS Segment(s)
PositionSequence
7-15RRRLRKKRE
42-55KPKKPNSAKRKVAR
121-126KKPKNK
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MTLNQVRRRLRKKREIAKPQSPQLMNCPQRRAVCSKIFSEVKPKKPNSAKRKVARVKLTTGKTVMAYIMGEGHNLQEHSVVLIRGGRTQDLPGVKYKIVRGAFDFNAVPNRVTSRSKYGVKKPKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.91
5 0.89
6 0.85
7 0.83
8 0.74
9 0.64
10 0.61
11 0.61
12 0.59
13 0.56
14 0.53
15 0.5
16 0.52
17 0.54
18 0.52
19 0.49
20 0.48
21 0.46
22 0.43
23 0.45
24 0.44
25 0.41
26 0.46
27 0.47
28 0.49
29 0.55
30 0.55
31 0.56
32 0.63
33 0.73
34 0.72
35 0.75
36 0.75
37 0.72
38 0.82
39 0.8
40 0.78
41 0.76
42 0.69
43 0.64
44 0.62
45 0.58
46 0.49
47 0.42
48 0.35
49 0.27
50 0.24
51 0.18
52 0.1
53 0.08
54 0.06
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.06
69 0.09
70 0.09
71 0.11
72 0.12
73 0.12
74 0.12
75 0.13
76 0.16
77 0.17
78 0.18
79 0.2
80 0.22
81 0.22
82 0.24
83 0.25
84 0.28
85 0.28
86 0.28
87 0.27
88 0.3
89 0.3
90 0.3
91 0.3
92 0.24
93 0.28
94 0.28
95 0.25
96 0.2
97 0.23
98 0.25
99 0.28
100 0.31
101 0.33
102 0.39
103 0.47
104 0.54
105 0.61
106 0.68