Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167L5C1

Protein Details
Accession A0A167L5C1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
216-262MSTSKSVEKPRPRERDRERDGREKYEPYPARNKDRDKDEKRSRWDVGBasic
NLS Segment(s)
PositionSequence
223-275EKPRPRERDRERDGREKYEPYPARNKDRDKDEKRSRWDVGAPPRDKKRENGRR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MLFFEWDKKHIAIPSLVCWAQVNAGTRAERESRQARDPEPGAYNPTSMPSRSDSVSSSSRLPPPRATTSLFPDAPGPSRARVQPDPDDEEAHLRALLRPPPVDGVDNWGIPARPDGEPDPALVAKLAKFHDLKRRGKHFNDTLMSNKAFRNPHIYEKLVNFVDVDEKGTNFPREIWDPFDYRPEWKAEALAEEQKRRSEALEAAQGRGKRTEISFMSTSKSVEKPRPRERDRERDGREKYEPYPARNKDRDKDEKRSRWDVGAPPRDKKRENGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.33
4 0.3
5 0.27
6 0.24
7 0.21
8 0.23
9 0.23
10 0.19
11 0.23
12 0.24
13 0.23
14 0.27
15 0.29
16 0.27
17 0.31
18 0.36
19 0.37
20 0.43
21 0.48
22 0.45
23 0.49
24 0.49
25 0.46
26 0.43
27 0.39
28 0.37
29 0.33
30 0.32
31 0.25
32 0.27
33 0.24
34 0.21
35 0.22
36 0.2
37 0.22
38 0.22
39 0.23
40 0.21
41 0.23
42 0.26
43 0.26
44 0.26
45 0.27
46 0.33
47 0.37
48 0.39
49 0.39
50 0.42
51 0.46
52 0.46
53 0.45
54 0.42
55 0.43
56 0.47
57 0.42
58 0.36
59 0.32
60 0.3
61 0.29
62 0.29
63 0.24
64 0.18
65 0.22
66 0.24
67 0.29
68 0.3
69 0.33
70 0.37
71 0.39
72 0.43
73 0.4
74 0.4
75 0.33
76 0.33
77 0.28
78 0.22
79 0.18
80 0.13
81 0.13
82 0.16
83 0.18
84 0.17
85 0.17
86 0.18
87 0.19
88 0.2
89 0.19
90 0.16
91 0.19
92 0.18
93 0.18
94 0.17
95 0.16
96 0.14
97 0.13
98 0.14
99 0.1
100 0.09
101 0.11
102 0.12
103 0.15
104 0.15
105 0.15
106 0.16
107 0.13
108 0.13
109 0.11
110 0.1
111 0.07
112 0.1
113 0.11
114 0.12
115 0.14
116 0.18
117 0.27
118 0.35
119 0.42
120 0.47
121 0.54
122 0.57
123 0.58
124 0.62
125 0.56
126 0.54
127 0.5
128 0.44
129 0.39
130 0.36
131 0.34
132 0.28
133 0.25
134 0.24
135 0.22
136 0.21
137 0.26
138 0.24
139 0.31
140 0.33
141 0.34
142 0.31
143 0.31
144 0.35
145 0.27
146 0.25
147 0.18
148 0.14
149 0.15
150 0.13
151 0.14
152 0.09
153 0.1
154 0.11
155 0.14
156 0.14
157 0.13
158 0.13
159 0.14
160 0.17
161 0.18
162 0.22
163 0.22
164 0.23
165 0.24
166 0.28
167 0.26
168 0.25
169 0.25
170 0.24
171 0.22
172 0.2
173 0.21
174 0.17
175 0.18
176 0.19
177 0.24
178 0.25
179 0.28
180 0.29
181 0.3
182 0.3
183 0.28
184 0.26
185 0.22
186 0.21
187 0.21
188 0.27
189 0.27
190 0.28
191 0.3
192 0.31
193 0.29
194 0.28
195 0.24
196 0.18
197 0.18
198 0.24
199 0.22
200 0.26
201 0.27
202 0.26
203 0.29
204 0.28
205 0.28
206 0.25
207 0.29
208 0.29
209 0.36
210 0.45
211 0.52
212 0.61
213 0.71
214 0.72
215 0.78
216 0.82
217 0.83
218 0.82
219 0.82
220 0.79
221 0.78
222 0.79
223 0.75
224 0.71
225 0.65
226 0.58
227 0.59
228 0.56
229 0.52
230 0.58
231 0.58
232 0.63
233 0.67
234 0.73
235 0.7
236 0.76
237 0.8
238 0.78
239 0.82
240 0.83
241 0.83
242 0.83
243 0.83
244 0.76
245 0.7
246 0.69
247 0.67
248 0.66
249 0.67
250 0.65
251 0.66
252 0.72
253 0.75
254 0.71
255 0.72