Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167FNW1

Protein Details
Accession A0A167FNW1    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPARKKPPTKQQPRPRRLKPTEPPPQTDHydrophilic
NLS Segment(s)
PositionSequence
4-19RKKPPTKQQPRPRRLK
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
Amino Acid Sequences MPARKKPPTKQQPRPRRLKPTEPPPQTDEAIAAEAEKIQMEINVDLFWEEDLRERAAMAANEDTLSSFRDAVNRLWDKFPDTIAGFPAHKVAFLQKNSQNIWRVSQPEGGTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.92
4 0.89
5 0.89
6 0.88
7 0.87
8 0.88
9 0.82
10 0.78
11 0.7
12 0.66
13 0.56
14 0.46
15 0.36
16 0.27
17 0.22
18 0.17
19 0.12
20 0.08
21 0.08
22 0.07
23 0.06
24 0.05
25 0.04
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.04
37 0.06
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.07
48 0.08
49 0.08
50 0.08
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.1
57 0.12
58 0.13
59 0.22
60 0.24
61 0.25
62 0.27
63 0.27
64 0.28
65 0.27
66 0.26
67 0.2
68 0.18
69 0.17
70 0.17
71 0.19
72 0.16
73 0.16
74 0.19
75 0.15
76 0.14
77 0.14
78 0.19
79 0.24
80 0.26
81 0.34
82 0.34
83 0.41
84 0.43
85 0.49
86 0.48
87 0.42
88 0.45
89 0.43
90 0.42
91 0.39
92 0.43