Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165M5I4

Protein Details
Accession A0A165M5I4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYVKQASKWRRNFIKKWDKEMESHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 7, mito 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045338  DUF6535  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20153  DUF6535  
Amino Acid Sequences MYVKQASKWRRNFIKKWDKEMESLLLFATLFSAVVTAFVVLAYPALCPDSGTASLDALEQIIDILRQNQATGPSNNATAPLSGEVTFHPKGYAVRVNSFWFGSLVISVSVAFLTILAKQWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.82
4 0.81
5 0.73
6 0.65
7 0.61
8 0.55
9 0.44
10 0.38
11 0.28
12 0.2
13 0.17
14 0.14
15 0.11
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.05
36 0.07
37 0.08
38 0.09
39 0.09
40 0.08
41 0.09
42 0.08
43 0.08
44 0.05
45 0.05
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.05
54 0.05
55 0.07
56 0.1
57 0.13
58 0.14
59 0.16
60 0.16
61 0.17
62 0.17
63 0.17
64 0.14
65 0.11
66 0.11
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.15
73 0.15
74 0.14
75 0.13
76 0.13
77 0.14
78 0.19
79 0.24
80 0.22
81 0.25
82 0.27
83 0.3
84 0.3
85 0.3
86 0.25
87 0.19
88 0.16
89 0.13
90 0.11
91 0.09
92 0.07
93 0.08
94 0.07
95 0.07
96 0.06
97 0.06
98 0.05
99 0.04
100 0.05
101 0.06