Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165SHB4

Protein Details
Accession A0A165SHB4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
118-148SIYNSRRRSVVQRDRRRRKQRRWIQAMFNDQHydrophilic
NLS Segment(s)
PositionSequence
124-139RRSVVQRDRRRRKQRR
Subcellular Location(s) nucl 14, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MSTEQAAMYRTDDNRDVTASASSKVHCLTDGTTTTVLRYYQSCGVLDVRRIGTPLEPHPAQEPSLPTIGNVHQVPTEYIAHWAEGSYSRHREMLNEMTEPGHDSAQRVACDLLEKRGSIYNSRRRSVVQRDRRRRKQRRWIQAMFNDQAALRSYDRIWQRELYKLLLALMQTPENFVMHIERDPGDPSKFVAALLLEIPYGRKVDSLDDPYFLLMDMATRGTADGGGAAALVDSSPSRSKSWFTHCDTVRFMPSWMPGAGFMWHALKMKEIVRLASHGPYEATKAAVRTGTATPSLIANRVEGAQRKGTFAEDERDIRTAAATSSSVGLDTNKGSLILAMVIYPNVFRKAQEEVDVVIGAHRLSPSWKTEASCHTLVVSSQKYCGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.28
4 0.23
5 0.27
6 0.23
7 0.23
8 0.22
9 0.21
10 0.22
11 0.23
12 0.22
13 0.18
14 0.18
15 0.18
16 0.22
17 0.23
18 0.24
19 0.25
20 0.24
21 0.24
22 0.24
23 0.23
24 0.18
25 0.18
26 0.19
27 0.22
28 0.24
29 0.24
30 0.24
31 0.28
32 0.3
33 0.31
34 0.32
35 0.29
36 0.27
37 0.27
38 0.26
39 0.24
40 0.26
41 0.27
42 0.29
43 0.27
44 0.28
45 0.31
46 0.31
47 0.29
48 0.28
49 0.27
50 0.22
51 0.24
52 0.23
53 0.2
54 0.22
55 0.22
56 0.24
57 0.21
58 0.19
59 0.18
60 0.19
61 0.2
62 0.19
63 0.2
64 0.14
65 0.17
66 0.17
67 0.16
68 0.15
69 0.14
70 0.12
71 0.15
72 0.19
73 0.22
74 0.25
75 0.26
76 0.28
77 0.29
78 0.29
79 0.3
80 0.34
81 0.3
82 0.28
83 0.27
84 0.25
85 0.25
86 0.26
87 0.21
88 0.15
89 0.13
90 0.13
91 0.17
92 0.21
93 0.21
94 0.19
95 0.18
96 0.17
97 0.21
98 0.21
99 0.21
100 0.18
101 0.18
102 0.19
103 0.23
104 0.24
105 0.27
106 0.36
107 0.4
108 0.45
109 0.47
110 0.46
111 0.45
112 0.52
113 0.56
114 0.57
115 0.58
116 0.63
117 0.73
118 0.83
119 0.91
120 0.94
121 0.94
122 0.94
123 0.94
124 0.93
125 0.93
126 0.92
127 0.88
128 0.85
129 0.81
130 0.77
131 0.67
132 0.57
133 0.46
134 0.36
135 0.3
136 0.22
137 0.18
138 0.11
139 0.11
140 0.12
141 0.17
142 0.21
143 0.22
144 0.23
145 0.24
146 0.26
147 0.3
148 0.31
149 0.28
150 0.24
151 0.22
152 0.2
153 0.17
154 0.15
155 0.11
156 0.11
157 0.1
158 0.09
159 0.1
160 0.1
161 0.08
162 0.08
163 0.07
164 0.07
165 0.07
166 0.08
167 0.08
168 0.09
169 0.09
170 0.11
171 0.13
172 0.13
173 0.12
174 0.12
175 0.12
176 0.11
177 0.1
178 0.09
179 0.07
180 0.07
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.05
189 0.06
190 0.06
191 0.09
192 0.13
193 0.18
194 0.18
195 0.18
196 0.19
197 0.18
198 0.17
199 0.14
200 0.1
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.05
222 0.07
223 0.09
224 0.1
225 0.12
226 0.15
227 0.2
228 0.29
229 0.35
230 0.39
231 0.46
232 0.46
233 0.49
234 0.5
235 0.47
236 0.41
237 0.34
238 0.28
239 0.22
240 0.21
241 0.2
242 0.17
243 0.15
244 0.12
245 0.12
246 0.13
247 0.11
248 0.1
249 0.09
250 0.11
251 0.12
252 0.12
253 0.12
254 0.14
255 0.16
256 0.2
257 0.19
258 0.19
259 0.18
260 0.21
261 0.22
262 0.21
263 0.2
264 0.15
265 0.15
266 0.14
267 0.16
268 0.14
269 0.14
270 0.13
271 0.13
272 0.14
273 0.14
274 0.14
275 0.14
276 0.15
277 0.15
278 0.15
279 0.15
280 0.13
281 0.15
282 0.16
283 0.15
284 0.14
285 0.13
286 0.13
287 0.14
288 0.18
289 0.19
290 0.22
291 0.27
292 0.27
293 0.28
294 0.28
295 0.28
296 0.28
297 0.26
298 0.27
299 0.25
300 0.27
301 0.27
302 0.27
303 0.26
304 0.23
305 0.21
306 0.16
307 0.12
308 0.12
309 0.1
310 0.1
311 0.11
312 0.11
313 0.1
314 0.1
315 0.1
316 0.1
317 0.11
318 0.11
319 0.1
320 0.1
321 0.1
322 0.1
323 0.09
324 0.08
325 0.07
326 0.06
327 0.07
328 0.07
329 0.07
330 0.08
331 0.1
332 0.13
333 0.13
334 0.14
335 0.16
336 0.22
337 0.24
338 0.28
339 0.27
340 0.25
341 0.26
342 0.26
343 0.23
344 0.18
345 0.16
346 0.12
347 0.11
348 0.1
349 0.09
350 0.12
351 0.16
352 0.19
353 0.24
354 0.27
355 0.28
356 0.34
357 0.4
358 0.44
359 0.41
360 0.37
361 0.33
362 0.31
363 0.31
364 0.33
365 0.31
366 0.26