Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165R4U6

Protein Details
Accession A0A165R4U6    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
250-270VVPSRLPKRSKARHARYPPSSHydrophilic
320-350KGAFRCPVPRCKYRPPSSRRRSDIRRHLESHBasic
NLS Segment(s)
PositionSequence
256-264PKRSKARHA
Subcellular Location(s) nucl 17, cyto 10
Family & Domain DBs
Amino Acid Sequences MLLLIGPCSETVLTAGDFDESSPCKSNEAACHENDVSEPVFEGATPVVNSSKLFVHAVMSAIEQDDGSTTAESSVSNTELAVNRSEVYPSVPFSTLDAEPLHTVYATTADSYAATSPLPSVSGDLVFSPASSPCSPCDSDSDGNIQPSYDTPATDSADYVAFSPVPSLQYPNSEELRRSASPSLSASSVSHSSFSPVPSPCYPDSSVAASPRLSGTFDYHPSYTGHSTSPPAIKEESILSRASRAAGITVVPSRLPKRSKARHARYPPSSSQALSRPRCDPPARKRKSSTSRNACDAQSPRPRNVQSPLDPARTAFTYTKGAFRCPVPRCKYRPPSSRRRSDIRRHLESHCSKQNQQRWVCCGVPVGQAEEYGITDVDTDAYMWRGWRMIGGCNKGFSRRDSLQRHLRSSVGCRGHVDMADLITELNDKALAEVAGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.1
5 0.11
6 0.15
7 0.15
8 0.19
9 0.23
10 0.23
11 0.23
12 0.25
13 0.3
14 0.33
15 0.4
16 0.41
17 0.37
18 0.44
19 0.42
20 0.41
21 0.36
22 0.31
23 0.23
24 0.18
25 0.17
26 0.11
27 0.11
28 0.1
29 0.11
30 0.08
31 0.1
32 0.1
33 0.11
34 0.11
35 0.12
36 0.13
37 0.13
38 0.15
39 0.14
40 0.15
41 0.14
42 0.15
43 0.15
44 0.16
45 0.14
46 0.13
47 0.12
48 0.11
49 0.11
50 0.09
51 0.08
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.1
62 0.1
63 0.1
64 0.1
65 0.13
66 0.15
67 0.17
68 0.17
69 0.16
70 0.16
71 0.16
72 0.17
73 0.13
74 0.14
75 0.14
76 0.15
77 0.17
78 0.17
79 0.17
80 0.17
81 0.21
82 0.17
83 0.18
84 0.17
85 0.15
86 0.15
87 0.15
88 0.14
89 0.1
90 0.1
91 0.08
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.08
98 0.08
99 0.09
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.08
114 0.08
115 0.08
116 0.08
117 0.12
118 0.12
119 0.13
120 0.13
121 0.18
122 0.19
123 0.19
124 0.23
125 0.25
126 0.26
127 0.26
128 0.29
129 0.26
130 0.26
131 0.25
132 0.2
133 0.15
134 0.14
135 0.18
136 0.13
137 0.12
138 0.12
139 0.15
140 0.17
141 0.17
142 0.16
143 0.11
144 0.12
145 0.12
146 0.11
147 0.09
148 0.07
149 0.07
150 0.07
151 0.07
152 0.09
153 0.09
154 0.1
155 0.1
156 0.14
157 0.16
158 0.2
159 0.22
160 0.21
161 0.22
162 0.21
163 0.26
164 0.23
165 0.24
166 0.22
167 0.2
168 0.2
169 0.21
170 0.2
171 0.15
172 0.15
173 0.13
174 0.13
175 0.14
176 0.13
177 0.12
178 0.11
179 0.13
180 0.13
181 0.14
182 0.16
183 0.15
184 0.18
185 0.18
186 0.23
187 0.22
188 0.24
189 0.25
190 0.22
191 0.22
192 0.21
193 0.22
194 0.19
195 0.2
196 0.15
197 0.15
198 0.13
199 0.12
200 0.1
201 0.09
202 0.11
203 0.13
204 0.15
205 0.16
206 0.16
207 0.17
208 0.17
209 0.19
210 0.17
211 0.15
212 0.13
213 0.12
214 0.14
215 0.15
216 0.17
217 0.15
218 0.16
219 0.15
220 0.15
221 0.15
222 0.16
223 0.15
224 0.14
225 0.14
226 0.12
227 0.13
228 0.13
229 0.13
230 0.1
231 0.09
232 0.07
233 0.07
234 0.07
235 0.07
236 0.08
237 0.08
238 0.08
239 0.11
240 0.12
241 0.18
242 0.21
243 0.27
244 0.36
245 0.45
246 0.55
247 0.64
248 0.71
249 0.75
250 0.82
251 0.83
252 0.8
253 0.77
254 0.69
255 0.63
256 0.56
257 0.46
258 0.4
259 0.38
260 0.41
261 0.38
262 0.38
263 0.37
264 0.38
265 0.45
266 0.48
267 0.5
268 0.52
269 0.6
270 0.63
271 0.66
272 0.69
273 0.73
274 0.77
275 0.78
276 0.77
277 0.77
278 0.75
279 0.73
280 0.71
281 0.61
282 0.58
283 0.51
284 0.49
285 0.49
286 0.47
287 0.45
288 0.5
289 0.51
290 0.48
291 0.51
292 0.5
293 0.44
294 0.49
295 0.52
296 0.47
297 0.46
298 0.42
299 0.38
300 0.31
301 0.31
302 0.22
303 0.2
304 0.23
305 0.23
306 0.29
307 0.27
308 0.29
309 0.27
310 0.3
311 0.36
312 0.36
313 0.45
314 0.47
315 0.55
316 0.6
317 0.69
318 0.76
319 0.77
320 0.81
321 0.8
322 0.84
323 0.85
324 0.88
325 0.84
326 0.83
327 0.83
328 0.83
329 0.85
330 0.83
331 0.81
332 0.75
333 0.73
334 0.74
335 0.71
336 0.69
337 0.67
338 0.63
339 0.62
340 0.67
341 0.69
342 0.69
343 0.69
344 0.67
345 0.63
346 0.63
347 0.57
348 0.49
349 0.44
350 0.38
351 0.35
352 0.3
353 0.28
354 0.22
355 0.21
356 0.2
357 0.18
358 0.15
359 0.11
360 0.1
361 0.07
362 0.07
363 0.07
364 0.07
365 0.06
366 0.06
367 0.06
368 0.08
369 0.09
370 0.09
371 0.1
372 0.1
373 0.1
374 0.14
375 0.15
376 0.21
377 0.28
378 0.35
379 0.36
380 0.39
381 0.41
382 0.43
383 0.45
384 0.41
385 0.42
386 0.41
387 0.5
388 0.53
389 0.61
390 0.65
391 0.7
392 0.71
393 0.65
394 0.62
395 0.56
396 0.56
397 0.56
398 0.51
399 0.45
400 0.42
401 0.44
402 0.43
403 0.39
404 0.35
405 0.27
406 0.22
407 0.21
408 0.18
409 0.14
410 0.11
411 0.12
412 0.09
413 0.08
414 0.08
415 0.07
416 0.08
417 0.09