Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MRH9

Protein Details
Accession A0A165MRH9    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-120QEFYKDKKYKPLDLRPKKTRAIRRRLTPHEKKQKTLKQRKRDIHFPLRKYBasic
NLS Segment(s)
PositionSequence
77-118KKYKPLDLRPKKTRAIRRRLTPHEKKQKTLKQRKRDIHFPLR
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLTELKNELLSLRVQKIAGGSAAKLTKINTVRKSIARVMTVMNQKQRQNLQEFYKDKKYKPLDLRPKKTRAIRRRLTPHEKKQKTLKQRKRDIHFPLRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.54
5 0.5
6 0.49
7 0.48
8 0.53
9 0.49
10 0.47
11 0.46
12 0.39
13 0.34
14 0.29
15 0.26
16 0.18
17 0.18
18 0.18
19 0.18
20 0.17
21 0.16
22 0.16
23 0.17
24 0.16
25 0.15
26 0.12
27 0.1
28 0.12
29 0.13
30 0.13
31 0.13
32 0.13
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.3
44 0.27
45 0.24
46 0.26
47 0.3
48 0.29
49 0.3
50 0.31
51 0.32
52 0.35
53 0.37
54 0.35
55 0.34
56 0.36
57 0.35
58 0.4
59 0.41
60 0.43
61 0.5
62 0.5
63 0.46
64 0.51
65 0.51
66 0.51
67 0.58
68 0.63
69 0.64
70 0.71
71 0.8
72 0.79
73 0.81
74 0.79
75 0.78
76 0.78
77 0.77
78 0.77
79 0.76
80 0.77
81 0.81
82 0.84
83 0.87
84 0.86
85 0.87
86 0.88
87 0.84
88 0.8
89 0.81
90 0.81
91 0.81
92 0.82
93 0.82
94 0.81
95 0.87
96 0.91
97 0.88
98 0.88
99 0.86
100 0.86
101 0.85
102 0.79
103 0.77
104 0.75
105 0.71