Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165MHF8

Protein Details
Accession A0A165MHF8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
161-189NAETQPRRRRGGRRPKDKGKGKGKGKEKABasic
NLS Segment(s)
PositionSequence
166-189PRRRRGGRRPKDKGKGKGKGKEKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042771  GTF3C6-like  
IPR019481  TFIIIC_triple_barrel  
Gene Ontology GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF10419  TFIIIC_sub6  
Amino Acid Sequences MPNPNTGNSSLAPGYKHVDAFGPDEEYESEEEVAYVTLDLGAVEPALVPSSSSFRLIGLDTSSPFLQLSGTVFKGQHQRLLGTELLFADAKEDNSDRTRKPLIHVGTSEQRIRFKEVEVKAKINKLPQDAEKIPAMSQAKGKNNKKDRMPETVEEVVGTVNAETQPRRRRGGRRPKDKGKGKGKGKEKAVDRPNDGMDMDDRGEGPSSTDVTPQETIGDAAADVDINTNGRGSPVADVHLLRQGDGSLVQWSSDAPEGPDPLSMDIDTSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.2
5 0.2
6 0.21
7 0.22
8 0.22
9 0.21
10 0.19
11 0.2
12 0.2
13 0.19
14 0.18
15 0.16
16 0.15
17 0.11
18 0.11
19 0.1
20 0.09
21 0.08
22 0.07
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.1
38 0.11
39 0.13
40 0.13
41 0.12
42 0.14
43 0.14
44 0.14
45 0.13
46 0.14
47 0.13
48 0.15
49 0.15
50 0.14
51 0.13
52 0.12
53 0.09
54 0.08
55 0.1
56 0.11
57 0.12
58 0.14
59 0.14
60 0.18
61 0.26
62 0.26
63 0.28
64 0.26
65 0.26
66 0.25
67 0.28
68 0.26
69 0.18
70 0.18
71 0.13
72 0.14
73 0.13
74 0.12
75 0.1
76 0.09
77 0.09
78 0.1
79 0.11
80 0.12
81 0.16
82 0.21
83 0.19
84 0.24
85 0.27
86 0.26
87 0.29
88 0.34
89 0.33
90 0.32
91 0.33
92 0.32
93 0.34
94 0.36
95 0.36
96 0.31
97 0.31
98 0.29
99 0.32
100 0.29
101 0.25
102 0.3
103 0.31
104 0.38
105 0.37
106 0.39
107 0.37
108 0.41
109 0.41
110 0.36
111 0.35
112 0.29
113 0.29
114 0.28
115 0.32
116 0.29
117 0.29
118 0.26
119 0.23
120 0.2
121 0.22
122 0.21
123 0.15
124 0.18
125 0.22
126 0.29
127 0.38
128 0.43
129 0.48
130 0.56
131 0.6
132 0.62
133 0.65
134 0.61
135 0.6
136 0.6
137 0.51
138 0.49
139 0.44
140 0.39
141 0.29
142 0.26
143 0.17
144 0.12
145 0.11
146 0.05
147 0.04
148 0.05
149 0.06
150 0.07
151 0.15
152 0.23
153 0.27
154 0.32
155 0.39
156 0.47
157 0.57
158 0.67
159 0.71
160 0.74
161 0.8
162 0.86
163 0.89
164 0.89
165 0.88
166 0.87
167 0.86
168 0.84
169 0.83
170 0.81
171 0.78
172 0.74
173 0.71
174 0.65
175 0.65
176 0.64
177 0.61
178 0.56
179 0.52
180 0.47
181 0.42
182 0.37
183 0.29
184 0.22
185 0.18
186 0.15
187 0.12
188 0.11
189 0.11
190 0.12
191 0.1
192 0.11
193 0.1
194 0.12
195 0.12
196 0.14
197 0.14
198 0.17
199 0.18
200 0.16
201 0.15
202 0.13
203 0.13
204 0.11
205 0.1
206 0.06
207 0.06
208 0.06
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.07
215 0.07
216 0.07
217 0.07
218 0.08
219 0.08
220 0.1
221 0.11
222 0.13
223 0.15
224 0.15
225 0.16
226 0.22
227 0.21
228 0.18
229 0.17
230 0.15
231 0.14
232 0.14
233 0.14
234 0.11
235 0.11
236 0.11
237 0.1
238 0.1
239 0.12
240 0.14
241 0.13
242 0.13
243 0.16
244 0.18
245 0.18
246 0.21
247 0.19
248 0.19
249 0.2
250 0.17