Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165L7S3

Protein Details
Accession A0A165L7S3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
60-79CGKRVSRKDAMKRYEKRCKABasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.333, mito_nucl 9.333, nucl 9, mito 8.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MAEIKRHLRAFHSVETRSESADKVVKCLWTGCTTDIRTDGLAKHLRDVHLRVGARRCSHCGKRVSRKDAMKRYEKRCKALQSALASEGTRNWGYGTPSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.45
4 0.39
5 0.35
6 0.27
7 0.24
8 0.27
9 0.25
10 0.22
11 0.23
12 0.22
13 0.21
14 0.22
15 0.21
16 0.19
17 0.21
18 0.2
19 0.24
20 0.24
21 0.24
22 0.23
23 0.22
24 0.19
25 0.18
26 0.17
27 0.17
28 0.21
29 0.2
30 0.22
31 0.23
32 0.24
33 0.25
34 0.26
35 0.23
36 0.23
37 0.24
38 0.24
39 0.27
40 0.3
41 0.31
42 0.31
43 0.32
44 0.34
45 0.38
46 0.42
47 0.45
48 0.51
49 0.58
50 0.66
51 0.69
52 0.69
53 0.74
54 0.77
55 0.77
56 0.76
57 0.75
58 0.75
59 0.78
60 0.81
61 0.78
62 0.74
63 0.72
64 0.72
65 0.68
66 0.66
67 0.63
68 0.57
69 0.54
70 0.5
71 0.45
72 0.38
73 0.31
74 0.26
75 0.24
76 0.19
77 0.16
78 0.16
79 0.17
80 0.2