Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165UE00

Protein Details
Accession A0A165UE00    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-48SSAIYRAKLRRRAHRRRRINRLLPNHRTEHydrophilic
NLS Segment(s)
PositionSequence
25-41RAKLRRRAHRRRRINRL
Subcellular Location(s) mito 16, extr 6, nucl 3
Family & Domain DBs
Amino Acid Sequences MYSTGLWTRCWLLSARGAASSAIYRAKLRRRAHRRRRINRLLPNHRTERNKYANVNVQRTPERTPPVHLGCARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.21
4 0.21
5 0.2
6 0.19
7 0.16
8 0.13
9 0.12
10 0.12
11 0.13
12 0.19
13 0.27
14 0.35
15 0.41
16 0.5
17 0.59
18 0.7
19 0.79
20 0.83
21 0.87
22 0.88
23 0.92
24 0.92
25 0.9
26 0.88
27 0.87
28 0.87
29 0.82
30 0.78
31 0.73
32 0.69
33 0.66
34 0.62
35 0.61
36 0.59
37 0.57
38 0.53
39 0.54
40 0.57
41 0.59
42 0.58
43 0.52
44 0.5
45 0.49
46 0.5
47 0.49
48 0.46
49 0.45
50 0.42
51 0.45
52 0.48
53 0.48
54 0.53