Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165U9X9

Protein Details
Accession A0A165U9X9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
60-81STKGEDKKRKLQLKKIFDRLKKBasic
NLS Segment(s)
PositionSequence
68-68R
Subcellular Location(s) cyto 14, cyto_nucl 12.333, nucl 8.5, mito_nucl 6.666
Family & Domain DBs
Amino Acid Sequences MDPNGSVSPAVVGAMKQRIIELEEQLAAQPPPAKRERKTHDPVSPAEAISSVAAPVASTSTKGEDKKRKLQLKKIFDRLKKDCKSDAVKFQGAPKTVKFDEVLGYDEFQFISGGRGTLIQPTPQNKPKSTVAIIEYRTKAAIEDLFGDELKALKGYAWTRGGAPYFSKSIKQGLVDVDIIQLEVTYSKNGMKCTLKFDVEEHGGGHCSFGPSHRASGFGRSFMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.17
5 0.18
6 0.2
7 0.22
8 0.19
9 0.17
10 0.17
11 0.17
12 0.17
13 0.18
14 0.15
15 0.15
16 0.17
17 0.16
18 0.23
19 0.3
20 0.37
21 0.39
22 0.5
23 0.57
24 0.62
25 0.69
26 0.71
27 0.7
28 0.68
29 0.65
30 0.6
31 0.53
32 0.43
33 0.35
34 0.26
35 0.2
36 0.16
37 0.14
38 0.08
39 0.06
40 0.06
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.11
48 0.16
49 0.2
50 0.29
51 0.37
52 0.45
53 0.53
54 0.62
55 0.68
56 0.71
57 0.78
58 0.79
59 0.8
60 0.81
61 0.82
62 0.81
63 0.76
64 0.78
65 0.76
66 0.76
67 0.7
68 0.66
69 0.58
70 0.56
71 0.58
72 0.54
73 0.54
74 0.5
75 0.47
76 0.44
77 0.46
78 0.43
79 0.39
80 0.36
81 0.28
82 0.28
83 0.26
84 0.27
85 0.22
86 0.18
87 0.17
88 0.16
89 0.18
90 0.12
91 0.13
92 0.11
93 0.11
94 0.1
95 0.08
96 0.07
97 0.05
98 0.06
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.1
105 0.1
106 0.11
107 0.14
108 0.17
109 0.23
110 0.29
111 0.33
112 0.31
113 0.35
114 0.36
115 0.37
116 0.36
117 0.33
118 0.28
119 0.3
120 0.31
121 0.32
122 0.3
123 0.25
124 0.24
125 0.21
126 0.18
127 0.14
128 0.13
129 0.08
130 0.1
131 0.1
132 0.11
133 0.11
134 0.1
135 0.09
136 0.09
137 0.08
138 0.06
139 0.05
140 0.05
141 0.09
142 0.1
143 0.15
144 0.17
145 0.17
146 0.18
147 0.21
148 0.21
149 0.19
150 0.2
151 0.17
152 0.19
153 0.2
154 0.21
155 0.2
156 0.23
157 0.23
158 0.22
159 0.22
160 0.2
161 0.22
162 0.21
163 0.19
164 0.16
165 0.14
166 0.13
167 0.1
168 0.08
169 0.05
170 0.05
171 0.06
172 0.06
173 0.07
174 0.11
175 0.14
176 0.15
177 0.21
178 0.27
179 0.28
180 0.34
181 0.39
182 0.37
183 0.36
184 0.36
185 0.38
186 0.34
187 0.33
188 0.27
189 0.22
190 0.22
191 0.21
192 0.2
193 0.14
194 0.13
195 0.13
196 0.14
197 0.19
198 0.2
199 0.25
200 0.24
201 0.27
202 0.26
203 0.35
204 0.36