Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165T1M9

Protein Details
Accession A0A165T1M9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
161-183GASNPHRRRVTRTQRDRDKLTRQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, nucl 6, mito 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042321  Ima1  
IPR018617  Ima1_N  
Gene Ontology GO:0005637  C:nuclear inner membrane  
GO:0071765  P:nuclear inner membrane organization  
Pfam View protein in Pfam  
PF09779  Ima1_N  
Amino Acid Sequences MSTIFKPHNSVTCFFCQSIISPIPRNPHSFRCPHCDCWNRFDANGEILSDEPAMHEESLNAQSFARRASPRKDRLPSMYASALFCRTCQTNQMLLANLLSNYLPPPDHPDFERRADMLPEYKHSIEARYPPVCADCAPAVEEEIRRRDNMARARALGGFLGASNPHRRRVTRTQRDRDKLTRQITFWKVRGCLWLACLVCTLGSYALVAVGYAGFHIPDSVKPGLPALAFVSILWTAWDPTYGSLKRAEYQGRTVRQQGKREYNTLQVIAWLSRCCTSLLLAMSRFQPEWDQLWPWTNPDSPLTRKYCIASLALELIILARCFTTLRLERPPPVRLTEAASQGKQSLASVTSAPTSHGATPAIEPDLLAPLSLSSKPVVIPPPGSSNPIFGMPSFVANPTAAMSGYGPDNNPFEDSAMDVEDDNEAGSRRRDPDAMDWTPTIPSPQKQTPQDPNVQGRSHDDGSWLRPQRFFAPEEPTGLESLFSTTIKLSDDEQAAAAARSGARRGNITQWLNPIKMLRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.32
4 0.29
5 0.34
6 0.34
7 0.32
8 0.32
9 0.36
10 0.42
11 0.46
12 0.51
13 0.49
14 0.52
15 0.56
16 0.6
17 0.62
18 0.63
19 0.66
20 0.66
21 0.71
22 0.72
23 0.68
24 0.67
25 0.69
26 0.63
27 0.56
28 0.54
29 0.46
30 0.39
31 0.36
32 0.29
33 0.22
34 0.19
35 0.2
36 0.16
37 0.13
38 0.09
39 0.1
40 0.11
41 0.11
42 0.1
43 0.1
44 0.13
45 0.18
46 0.19
47 0.18
48 0.16
49 0.18
50 0.19
51 0.21
52 0.24
53 0.26
54 0.31
55 0.4
56 0.5
57 0.57
58 0.66
59 0.71
60 0.7
61 0.71
62 0.69
63 0.61
64 0.56
65 0.51
66 0.43
67 0.38
68 0.34
69 0.31
70 0.27
71 0.25
72 0.23
73 0.21
74 0.21
75 0.25
76 0.27
77 0.28
78 0.31
79 0.33
80 0.31
81 0.29
82 0.28
83 0.24
84 0.19
85 0.15
86 0.12
87 0.1
88 0.09
89 0.1
90 0.09
91 0.09
92 0.17
93 0.2
94 0.22
95 0.25
96 0.31
97 0.34
98 0.38
99 0.4
100 0.33
101 0.31
102 0.31
103 0.31
104 0.3
105 0.28
106 0.27
107 0.29
108 0.28
109 0.3
110 0.28
111 0.29
112 0.27
113 0.31
114 0.35
115 0.31
116 0.31
117 0.29
118 0.29
119 0.27
120 0.23
121 0.21
122 0.14
123 0.14
124 0.15
125 0.14
126 0.13
127 0.15
128 0.18
129 0.19
130 0.23
131 0.24
132 0.23
133 0.26
134 0.29
135 0.34
136 0.39
137 0.41
138 0.38
139 0.39
140 0.4
141 0.38
142 0.34
143 0.26
144 0.18
145 0.12
146 0.09
147 0.08
148 0.07
149 0.09
150 0.18
151 0.2
152 0.26
153 0.3
154 0.32
155 0.39
156 0.5
157 0.59
158 0.61
159 0.7
160 0.74
161 0.81
162 0.85
163 0.84
164 0.81
165 0.78
166 0.76
167 0.71
168 0.64
169 0.55
170 0.57
171 0.57
172 0.55
173 0.5
174 0.45
175 0.41
176 0.38
177 0.4
178 0.34
179 0.27
180 0.22
181 0.25
182 0.2
183 0.19
184 0.18
185 0.15
186 0.12
187 0.11
188 0.11
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.05
206 0.1
207 0.11
208 0.11
209 0.11
210 0.12
211 0.13
212 0.12
213 0.12
214 0.08
215 0.08
216 0.08
217 0.07
218 0.08
219 0.07
220 0.07
221 0.06
222 0.06
223 0.05
224 0.05
225 0.06
226 0.05
227 0.06
228 0.13
229 0.13
230 0.15
231 0.17
232 0.18
233 0.19
234 0.23
235 0.25
236 0.19
237 0.26
238 0.32
239 0.32
240 0.33
241 0.39
242 0.44
243 0.46
244 0.51
245 0.51
246 0.54
247 0.53
248 0.55
249 0.5
250 0.46
251 0.42
252 0.36
253 0.29
254 0.2
255 0.18
256 0.15
257 0.15
258 0.09
259 0.09
260 0.09
261 0.1
262 0.09
263 0.09
264 0.09
265 0.11
266 0.12
267 0.13
268 0.13
269 0.13
270 0.14
271 0.15
272 0.14
273 0.12
274 0.11
275 0.11
276 0.12
277 0.13
278 0.13
279 0.13
280 0.16
281 0.16
282 0.17
283 0.17
284 0.16
285 0.16
286 0.17
287 0.21
288 0.21
289 0.28
290 0.3
291 0.29
292 0.3
293 0.3
294 0.29
295 0.26
296 0.23
297 0.17
298 0.14
299 0.13
300 0.12
301 0.1
302 0.08
303 0.07
304 0.07
305 0.06
306 0.05
307 0.04
308 0.04
309 0.05
310 0.06
311 0.12
312 0.15
313 0.19
314 0.27
315 0.29
316 0.35
317 0.39
318 0.42
319 0.37
320 0.37
321 0.35
322 0.29
323 0.31
324 0.3
325 0.33
326 0.32
327 0.3
328 0.28
329 0.26
330 0.26
331 0.21
332 0.17
333 0.1
334 0.08
335 0.09
336 0.09
337 0.09
338 0.1
339 0.1
340 0.11
341 0.11
342 0.12
343 0.11
344 0.12
345 0.12
346 0.12
347 0.12
348 0.13
349 0.12
350 0.1
351 0.1
352 0.09
353 0.11
354 0.1
355 0.09
356 0.07
357 0.07
358 0.09
359 0.09
360 0.1
361 0.08
362 0.09
363 0.09
364 0.13
365 0.15
366 0.15
367 0.17
368 0.18
369 0.25
370 0.25
371 0.29
372 0.26
373 0.24
374 0.24
375 0.24
376 0.22
377 0.15
378 0.17
379 0.14
380 0.16
381 0.15
382 0.14
383 0.13
384 0.13
385 0.13
386 0.1
387 0.1
388 0.08
389 0.08
390 0.08
391 0.08
392 0.09
393 0.1
394 0.1
395 0.12
396 0.13
397 0.13
398 0.14
399 0.13
400 0.13
401 0.12
402 0.12
403 0.11
404 0.1
405 0.1
406 0.09
407 0.09
408 0.08
409 0.08
410 0.07
411 0.07
412 0.07
413 0.09
414 0.11
415 0.15
416 0.18
417 0.21
418 0.22
419 0.24
420 0.32
421 0.39
422 0.39
423 0.39
424 0.36
425 0.34
426 0.34
427 0.31
428 0.28
429 0.23
430 0.24
431 0.28
432 0.35
433 0.42
434 0.48
435 0.57
436 0.62
437 0.64
438 0.7
439 0.69
440 0.7
441 0.68
442 0.64
443 0.56
444 0.52
445 0.52
446 0.45
447 0.38
448 0.34
449 0.31
450 0.34
451 0.42
452 0.43
453 0.4
454 0.4
455 0.42
456 0.44
457 0.46
458 0.44
459 0.4
460 0.4
461 0.39
462 0.4
463 0.39
464 0.34
465 0.31
466 0.27
467 0.22
468 0.15
469 0.16
470 0.14
471 0.12
472 0.12
473 0.11
474 0.13
475 0.14
476 0.15
477 0.15
478 0.19
479 0.2
480 0.2
481 0.2
482 0.2
483 0.19
484 0.18
485 0.16
486 0.12
487 0.12
488 0.13
489 0.15
490 0.18
491 0.19
492 0.23
493 0.26
494 0.31
495 0.39
496 0.42
497 0.43
498 0.49
499 0.53
500 0.49
501 0.49
502 0.48