Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X7S7

Protein Details
Accession G2X7S7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-79MIRSNKKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
64-79NKKKAAKAKAAAKKKA
Subcellular Location(s) cyto 10, mito 8, nucl 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0016757  F:glycosyltransferase activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
KEGG vda:VDAG_06535  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MAHAPEKQRNGKRLTCPQPFVDDDHPLQSLFPARVWAIRIPVILILLASAVVGSFLGTVMIRSNKKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.69
4 0.63
5 0.62
6 0.56
7 0.52
8 0.45
9 0.39
10 0.33
11 0.31
12 0.29
13 0.23
14 0.21
15 0.17
16 0.16
17 0.12
18 0.11
19 0.1
20 0.1
21 0.11
22 0.13
23 0.13
24 0.12
25 0.12
26 0.12
27 0.11
28 0.11
29 0.09
30 0.07
31 0.06
32 0.04
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.03
45 0.04
46 0.07
47 0.13
48 0.18
49 0.21
50 0.27
51 0.34
52 0.4
53 0.48
54 0.54
55 0.59
56 0.65
57 0.7
58 0.75
59 0.78