Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165LZV5

Protein Details
Accession A0A165LZV5    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-123EPAPTPAKRKRAPRKVAASKAKAKHydrophilic
137-162GEHAEPPPKKRARRTSKKTSAQVEENHydrophilic
NLS Segment(s)
PositionSequence
72-123TPKRTRGRKAGVANSKASAKAKAEKVDEEPAPTPAKRKRAPRKVAASKAKAK
143-154PPKKRARRTSKK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPKCANPLFLRWVKQFHDEKDYRKRGGPPRATGYENAIRALEMCTEAHARQGLWEKLEEHCERRGLHMPEPTPKRTRGRKAGVANSKASAKAKAEKVDEEPAPTPAKRKRAPRKVAASKAKAKDDEDKDSEEDYEGGEHAEPPPKKRARRTSKKTSAQVEENGDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.49
4 0.54
5 0.53
6 0.57
7 0.63
8 0.67
9 0.61
10 0.6
11 0.65
12 0.64
13 0.7
14 0.7
15 0.66
16 0.67
17 0.68
18 0.64
19 0.56
20 0.54
21 0.49
22 0.42
23 0.35
24 0.27
25 0.23
26 0.21
27 0.21
28 0.15
29 0.1
30 0.09
31 0.1
32 0.12
33 0.12
34 0.14
35 0.13
36 0.12
37 0.15
38 0.22
39 0.21
40 0.2
41 0.21
42 0.2
43 0.21
44 0.28
45 0.27
46 0.22
47 0.24
48 0.26
49 0.25
50 0.28
51 0.34
52 0.31
53 0.33
54 0.35
55 0.34
56 0.39
57 0.43
58 0.43
59 0.39
60 0.41
61 0.45
62 0.49
63 0.55
64 0.56
65 0.58
66 0.62
67 0.64
68 0.68
69 0.67
70 0.61
71 0.54
72 0.46
73 0.4
74 0.34
75 0.29
76 0.22
77 0.16
78 0.19
79 0.22
80 0.25
81 0.26
82 0.26
83 0.28
84 0.31
85 0.29
86 0.27
87 0.24
88 0.22
89 0.23
90 0.22
91 0.25
92 0.26
93 0.34
94 0.37
95 0.47
96 0.56
97 0.64
98 0.72
99 0.75
100 0.8
101 0.81
102 0.86
103 0.84
104 0.81
105 0.79
106 0.77
107 0.72
108 0.64
109 0.57
110 0.57
111 0.52
112 0.52
113 0.46
114 0.44
115 0.4
116 0.39
117 0.36
118 0.27
119 0.22
120 0.15
121 0.13
122 0.1
123 0.09
124 0.08
125 0.08
126 0.1
127 0.18
128 0.19
129 0.23
130 0.33
131 0.4
132 0.48
133 0.58
134 0.67
135 0.7
136 0.79
137 0.85
138 0.86
139 0.89
140 0.92
141 0.9
142 0.87
143 0.83
144 0.78
145 0.75