Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165P3X6

Protein Details
Accession A0A165P3X6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPQGPRRKDPLETQBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPQGPRRK
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQGPRRKDPLETQFTCLFCHHDKSVTVRLDRKEGIAQLFCKVCDQRYQSKVNHLTEPIDIYSEWIDAADAAEKEILSNRRTTAGSSRGAPVANFGSDNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.91
3 0.88
4 0.81
5 0.79
6 0.78
7 0.76
8 0.68
9 0.63
10 0.59
11 0.52
12 0.49
13 0.4
14 0.35
15 0.27
16 0.3
17 0.26
18 0.24
19 0.24
20 0.28
21 0.35
22 0.35
23 0.36
24 0.37
25 0.37
26 0.39
27 0.38
28 0.34
29 0.28
30 0.26
31 0.25
32 0.22
33 0.21
34 0.2
35 0.2
36 0.18
37 0.18
38 0.17
39 0.15
40 0.18
41 0.22
42 0.27
43 0.31
44 0.37
45 0.36
46 0.44
47 0.5
48 0.46
49 0.44
50 0.38
51 0.34
52 0.29
53 0.29
54 0.2
55 0.15
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.06
62 0.06
63 0.05
64 0.06
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.13
72 0.17
73 0.15
74 0.18
75 0.18
76 0.22
77 0.22
78 0.25
79 0.27
80 0.29
81 0.31
82 0.31
83 0.33
84 0.31
85 0.31
86 0.28
87 0.25
88 0.22
89 0.2