Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165LM82

Protein Details
Accession A0A165LM82    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
329-351MGVRINSREHERKRRAPSRGSGGBasic
NLS Segment(s)
PositionSequence
339-347ERKRRAPSR
Subcellular Location(s) mito 11, cyto 9, nucl 4, plas 1, pero 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021740  Velvet  
IPR037525  Velvet_dom  
IPR038491  Velvet_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF11754  Velvet  
PROSITE View protein in PROSITE  
PS51821  VELVET  
Amino Acid Sequences MSGPSAALQSAPLLNDPFSRPVPFVAGHFSGRTIRVQLDELQHAEVGRKCGTKDRRPLDPPPVVGVRLFEVVNAGTPFEEEHELLDPSEVDSHGFICYAELYASDQQALGTSSAFGESRASSARLMLVPSGPGPPSLPPLMLHHVGSSSQMLPGPGSPQTMTGEQPTIVSPIVNSHSMGGWTNFPLREHNSFSMPAAPLGMTTGGNMASYYPAITGSEPMSICPADPQSFSVGNQPCCTELLVGSTFVASTFVEQPGKKIVFAFADLAVKEDGLYSLRYKVFNIFNIALGSVPAPVLAGCCGDAFRVYSTKDFPGLHASTELTKQISRMGVRINSREHERKRRAPSRGSGGVGRLMALATRPGSPSSQAAGGHESAYLRSLPHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.21
4 0.24
5 0.25
6 0.26
7 0.25
8 0.25
9 0.28
10 0.26
11 0.24
12 0.26
13 0.26
14 0.26
15 0.25
16 0.26
17 0.25
18 0.26
19 0.26
20 0.22
21 0.21
22 0.21
23 0.23
24 0.26
25 0.28
26 0.3
27 0.3
28 0.28
29 0.27
30 0.25
31 0.28
32 0.25
33 0.24
34 0.24
35 0.25
36 0.25
37 0.34
38 0.43
39 0.48
40 0.56
41 0.57
42 0.63
43 0.67
44 0.73
45 0.73
46 0.7
47 0.62
48 0.57
49 0.54
50 0.45
51 0.39
52 0.33
53 0.25
54 0.21
55 0.19
56 0.13
57 0.12
58 0.11
59 0.14
60 0.12
61 0.11
62 0.08
63 0.09
64 0.09
65 0.1
66 0.12
67 0.09
68 0.1
69 0.12
70 0.13
71 0.13
72 0.13
73 0.11
74 0.09
75 0.11
76 0.1
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.06
84 0.07
85 0.06
86 0.06
87 0.06
88 0.09
89 0.11
90 0.11
91 0.11
92 0.11
93 0.1
94 0.11
95 0.11
96 0.08
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.09
106 0.1
107 0.11
108 0.1
109 0.11
110 0.13
111 0.12
112 0.12
113 0.11
114 0.1
115 0.1
116 0.1
117 0.11
118 0.1
119 0.09
120 0.1
121 0.1
122 0.12
123 0.12
124 0.12
125 0.12
126 0.15
127 0.19
128 0.2
129 0.19
130 0.16
131 0.16
132 0.15
133 0.15
134 0.13
135 0.09
136 0.08
137 0.09
138 0.09
139 0.08
140 0.09
141 0.09
142 0.09
143 0.1
144 0.09
145 0.1
146 0.12
147 0.13
148 0.13
149 0.13
150 0.13
151 0.12
152 0.12
153 0.11
154 0.1
155 0.09
156 0.08
157 0.06
158 0.08
159 0.1
160 0.1
161 0.1
162 0.09
163 0.09
164 0.1
165 0.1
166 0.09
167 0.08
168 0.08
169 0.11
170 0.11
171 0.11
172 0.13
173 0.16
174 0.18
175 0.21
176 0.22
177 0.21
178 0.21
179 0.21
180 0.21
181 0.18
182 0.14
183 0.11
184 0.1
185 0.08
186 0.08
187 0.08
188 0.05
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.06
203 0.06
204 0.09
205 0.09
206 0.09
207 0.11
208 0.1
209 0.1
210 0.1
211 0.12
212 0.1
213 0.11
214 0.12
215 0.14
216 0.14
217 0.15
218 0.21
219 0.24
220 0.24
221 0.25
222 0.24
223 0.21
224 0.21
225 0.21
226 0.14
227 0.09
228 0.11
229 0.11
230 0.1
231 0.1
232 0.09
233 0.08
234 0.08
235 0.08
236 0.05
237 0.06
238 0.08
239 0.1
240 0.14
241 0.14
242 0.16
243 0.22
244 0.22
245 0.21
246 0.19
247 0.19
248 0.17
249 0.18
250 0.18
251 0.13
252 0.14
253 0.14
254 0.15
255 0.13
256 0.12
257 0.1
258 0.09
259 0.08
260 0.07
261 0.09
262 0.08
263 0.13
264 0.16
265 0.17
266 0.17
267 0.22
268 0.25
269 0.26
270 0.3
271 0.26
272 0.25
273 0.25
274 0.24
275 0.18
276 0.15
277 0.13
278 0.07
279 0.06
280 0.05
281 0.04
282 0.04
283 0.05
284 0.05
285 0.05
286 0.06
287 0.06
288 0.06
289 0.07
290 0.07
291 0.08
292 0.1
293 0.13
294 0.14
295 0.16
296 0.19
297 0.21
298 0.25
299 0.24
300 0.23
301 0.28
302 0.28
303 0.26
304 0.24
305 0.24
306 0.21
307 0.23
308 0.23
309 0.17
310 0.17
311 0.16
312 0.19
313 0.23
314 0.22
315 0.23
316 0.27
317 0.31
318 0.37
319 0.41
320 0.42
321 0.42
322 0.5
323 0.57
324 0.6
325 0.65
326 0.69
327 0.73
328 0.79
329 0.84
330 0.83
331 0.82
332 0.81
333 0.8
334 0.77
335 0.71
336 0.63
337 0.56
338 0.51
339 0.42
340 0.34
341 0.25
342 0.18
343 0.15
344 0.13
345 0.13
346 0.11
347 0.13
348 0.14
349 0.15
350 0.17
351 0.19
352 0.21
353 0.21
354 0.24
355 0.23
356 0.23
357 0.26
358 0.25
359 0.23
360 0.21
361 0.19
362 0.16
363 0.17
364 0.15