Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PMH2

Protein Details
Accession A0A165PMH2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22QTKKRRNNGRNKKGRGHVKFVRBasic
84-114VRVRSREGRRNRAPPPRVRWKDGKKVNPAVAHydrophilic
NLS Segment(s)
PositionSequence
3-16KKRRNNGRNKKGRG
87-108RSREGRRNRAPPPRVRWKDGKK
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences QTKKRRNNGRNKKGRGHVKFVRCSNCSRCVGKDKAIKRFTVRNMVESAAVRDISDASVYAEYVIPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRVRWKDGKKVNPAVAAAEDAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.84
3 0.82
4 0.8
5 0.78
6 0.78
7 0.76
8 0.74
9 0.65
10 0.65
11 0.61
12 0.61
13 0.57
14 0.52
15 0.5
16 0.5
17 0.52
18 0.53
19 0.55
20 0.54
21 0.58
22 0.58
23 0.56
24 0.52
25 0.55
26 0.51
27 0.54
28 0.48
29 0.4
30 0.39
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.11
58 0.13
59 0.14
60 0.14
61 0.15
62 0.14
63 0.13
64 0.13
65 0.14
66 0.19
67 0.18
68 0.22
69 0.24
70 0.29
71 0.3
72 0.32
73 0.35
74 0.37
75 0.44
76 0.49
77 0.56
78 0.61
79 0.68
80 0.73
81 0.76
82 0.78
83 0.8
84 0.8
85 0.8
86 0.81
87 0.79
88 0.77
89 0.79
90 0.78
91 0.8
92 0.81
93 0.81
94 0.79
95 0.81
96 0.79
97 0.72
98 0.63
99 0.55
100 0.46