Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165M7Z9

Protein Details
Accession A0A165M7Z9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-84AHLVHKHKQNKAKNKKRDLDEBasic
NLS Segment(s)
PositionSequence
72-79QNKAKNKK
Subcellular Location(s) extr 14, E.R. 5, golg 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRFSGVLAVIALSAAASPVMSRPVFARDYDDLLVREPLAYEELDARGIFGFITHGISAAAHGIAHLVHKHKQNKAKNKKRDLDELEPFERDLDGLELFERDLAELDLFERALPESDLLEREYYDYGYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.09
7 0.09
8 0.1
9 0.11
10 0.16
11 0.17
12 0.18
13 0.22
14 0.2
15 0.24
16 0.24
17 0.25
18 0.21
19 0.21
20 0.21
21 0.16
22 0.14
23 0.1
24 0.1
25 0.09
26 0.08
27 0.07
28 0.08
29 0.08
30 0.09
31 0.09
32 0.08
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.04
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.06
53 0.08
54 0.12
55 0.19
56 0.24
57 0.3
58 0.39
59 0.48
60 0.58
61 0.67
62 0.73
63 0.77
64 0.82
65 0.84
66 0.79
67 0.8
68 0.76
69 0.73
70 0.7
71 0.65
72 0.57
73 0.5
74 0.45
75 0.36
76 0.28
77 0.2
78 0.13
79 0.09
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.07
87 0.06
88 0.06
89 0.07
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.09
100 0.09
101 0.1
102 0.12
103 0.13
104 0.14
105 0.14
106 0.13
107 0.15
108 0.15