Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165U6S5

Protein Details
Accession A0A165U6S5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
48-70PALAGGTRRKNNKKNLIVRNEDIHydrophilic
241-268HMAERAQQKKERREKQLMRQTRYQNKDSHydrophilic
NLS Segment(s)
PositionSequence
128-140KKRLEAEKKKAKR
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MPPIGAFARMSVCVLRAATRGSLRQMVVHPFRARPVASTSHFIHSSAPALAGGTRRKNNKKNLIVRNEDIPFRVVKLVDRETGRLGDEWLALADILKTVDRKREYLELVGEKPDPIVKVFKSSDIFNKKRLEAEKKKAKRVQKEVQVSWAISPGDLEHKLEKVREELEAGNRVDLAYVTKSGQAKPTKEQMGARAEESVKVLSDVGTEWKERTVTKTALVIHWQGQNEPTAEATMDHLKAHMAERAQQKKERREKQLMRQTRYQNKDSENPAPSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.17
5 0.21
6 0.24
7 0.26
8 0.28
9 0.32
10 0.3
11 0.32
12 0.34
13 0.38
14 0.39
15 0.44
16 0.43
17 0.4
18 0.42
19 0.43
20 0.39
21 0.33
22 0.33
23 0.32
24 0.32
25 0.36
26 0.36
27 0.37
28 0.37
29 0.35
30 0.32
31 0.26
32 0.25
33 0.2
34 0.17
35 0.12
36 0.11
37 0.13
38 0.16
39 0.21
40 0.26
41 0.32
42 0.41
43 0.51
44 0.59
45 0.68
46 0.73
47 0.77
48 0.8
49 0.84
50 0.83
51 0.8
52 0.74
53 0.7
54 0.62
55 0.53
56 0.44
57 0.35
58 0.27
59 0.21
60 0.21
61 0.15
62 0.15
63 0.2
64 0.22
65 0.26
66 0.27
67 0.27
68 0.26
69 0.27
70 0.25
71 0.19
72 0.17
73 0.14
74 0.12
75 0.11
76 0.09
77 0.08
78 0.07
79 0.06
80 0.05
81 0.04
82 0.05
83 0.05
84 0.07
85 0.09
86 0.16
87 0.18
88 0.19
89 0.21
90 0.26
91 0.27
92 0.27
93 0.3
94 0.26
95 0.26
96 0.27
97 0.24
98 0.19
99 0.17
100 0.16
101 0.12
102 0.1
103 0.13
104 0.11
105 0.16
106 0.17
107 0.2
108 0.2
109 0.21
110 0.28
111 0.35
112 0.36
113 0.37
114 0.4
115 0.37
116 0.4
117 0.45
118 0.46
119 0.46
120 0.54
121 0.59
122 0.61
123 0.69
124 0.71
125 0.72
126 0.71
127 0.71
128 0.69
129 0.68
130 0.7
131 0.61
132 0.6
133 0.55
134 0.46
135 0.36
136 0.31
137 0.22
138 0.14
139 0.13
140 0.09
141 0.11
142 0.11
143 0.12
144 0.1
145 0.12
146 0.14
147 0.14
148 0.15
149 0.13
150 0.14
151 0.13
152 0.14
153 0.14
154 0.17
155 0.21
156 0.2
157 0.18
158 0.17
159 0.17
160 0.15
161 0.13
162 0.11
163 0.07
164 0.08
165 0.08
166 0.12
167 0.14
168 0.15
169 0.22
170 0.26
171 0.28
172 0.31
173 0.38
174 0.38
175 0.39
176 0.4
177 0.39
178 0.39
179 0.37
180 0.34
181 0.3
182 0.27
183 0.25
184 0.24
185 0.19
186 0.13
187 0.12
188 0.11
189 0.08
190 0.08
191 0.08
192 0.1
193 0.12
194 0.12
195 0.12
196 0.14
197 0.16
198 0.16
199 0.2
200 0.23
201 0.22
202 0.23
203 0.27
204 0.27
205 0.28
206 0.3
207 0.28
208 0.26
209 0.28
210 0.27
211 0.24
212 0.23
213 0.23
214 0.21
215 0.19
216 0.16
217 0.12
218 0.12
219 0.12
220 0.14
221 0.16
222 0.15
223 0.15
224 0.15
225 0.14
226 0.16
227 0.17
228 0.17
229 0.14
230 0.2
231 0.3
232 0.39
233 0.45
234 0.5
235 0.58
236 0.65
237 0.75
238 0.77
239 0.77
240 0.79
241 0.83
242 0.87
243 0.89
244 0.89
245 0.85
246 0.84
247 0.85
248 0.84
249 0.82
250 0.76
251 0.72
252 0.68
253 0.69
254 0.67
255 0.66
256 0.59