Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165SWS0

Protein Details
Accession A0A165SWS0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85VVEKRPRRWIEEARPKQPNPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 7, mito 5, E.R. 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031459  Coa2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF17051  COA2  
Amino Acid Sequences MSASRVLHPTPQQRRKFVSTLFGLTFLASVITVSASNVLPCPAHDRGRFADGQVGEGMTGQRAVTVVEKRPRRWIEEARPKQPNPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.68
4 0.6
5 0.56
6 0.5
7 0.47
8 0.41
9 0.35
10 0.29
11 0.24
12 0.21
13 0.13
14 0.1
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.06
27 0.06
28 0.12
29 0.13
30 0.18
31 0.19
32 0.22
33 0.23
34 0.26
35 0.26
36 0.21
37 0.23
38 0.18
39 0.18
40 0.15
41 0.13
42 0.1
43 0.11
44 0.1
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.06
51 0.1
52 0.14
53 0.21
54 0.29
55 0.36
56 0.38
57 0.48
58 0.51
59 0.53
60 0.57
61 0.6
62 0.63
63 0.69
64 0.76
65 0.75
66 0.81