Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PDA8

Protein Details
Accession A0A165PDA8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-30SVTANRLPPKDKPRKHCRELKKITFGRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MRSVTANRLPPKDKPRKHCRELKKITFGRVIQCRTGHGYFGEYYPYHVPSDSNDCSCGAPLRTCSHIIKDCPRYESHRDTLRATCSRIVPSTEPSNAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.81
4 0.86
5 0.87
6 0.87
7 0.87
8 0.89
9 0.87
10 0.87
11 0.8
12 0.76
13 0.73
14 0.64
15 0.61
16 0.57
17 0.51
18 0.44
19 0.41
20 0.38
21 0.37
22 0.35
23 0.28
24 0.21
25 0.2
26 0.17
27 0.17
28 0.18
29 0.12
30 0.14
31 0.14
32 0.15
33 0.13
34 0.13
35 0.12
36 0.11
37 0.18
38 0.18
39 0.17
40 0.16
41 0.17
42 0.17
43 0.17
44 0.17
45 0.12
46 0.11
47 0.14
48 0.16
49 0.17
50 0.21
51 0.21
52 0.25
53 0.29
54 0.32
55 0.38
56 0.44
57 0.44
58 0.44
59 0.46
60 0.46
61 0.49
62 0.52
63 0.51
64 0.51
65 0.51
66 0.52
67 0.53
68 0.55
69 0.51
70 0.47
71 0.43
72 0.39
73 0.4
74 0.39
75 0.39
76 0.34
77 0.36
78 0.39