Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NAJ4

Protein Details
Accession A0A165NAJ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-33SIYTLRRTRRAHRVANKPRSEQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MNVRRCWCRRGSIYTLRRTRRAHRVANKPRSEQGIAVTFVMLLSAQVERHCAMGYSCQEIYTPRLMHAVFEGSHTAMGRVRLVGRTSERECKHLLFFDVALEPHVRLSCLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.73
4 0.75
5 0.72
6 0.72
7 0.72
8 0.72
9 0.72
10 0.72
11 0.78
12 0.81
13 0.86
14 0.84
15 0.77
16 0.72
17 0.67
18 0.59
19 0.48
20 0.41
21 0.35
22 0.29
23 0.25
24 0.21
25 0.15
26 0.13
27 0.12
28 0.08
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.11
41 0.12
42 0.14
43 0.14
44 0.13
45 0.14
46 0.14
47 0.17
48 0.17
49 0.16
50 0.13
51 0.16
52 0.16
53 0.16
54 0.16
55 0.15
56 0.1
57 0.11
58 0.12
59 0.09
60 0.1
61 0.1
62 0.1
63 0.09
64 0.1
65 0.1
66 0.1
67 0.11
68 0.13
69 0.14
70 0.18
71 0.2
72 0.26
73 0.3
74 0.39
75 0.39
76 0.4
77 0.41
78 0.4
79 0.39
80 0.35
81 0.33
82 0.26
83 0.25
84 0.24
85 0.23
86 0.2
87 0.19
88 0.17
89 0.15
90 0.15
91 0.16