Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165TPV9

Protein Details
Accession A0A165TPV9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTLNQSMRSKHPPKKRARATAPLLNNCHydrophilic
NLS Segment(s)
PositionSequence
10-17KHPPKKRA
49-50KR
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MTLNQSMRSKHPPKKRARATAPLLNNCPQRKGMAMQIFIMSPKKPNSAKRKVARVKLTNGNVVHAYINGEGNLMHDHAIVLVRGGRAQDLPGVRYKVVRGVYDHPSVVGRLTARSKYGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.87
4 0.86
5 0.87
6 0.83
7 0.83
8 0.8
9 0.76
10 0.7
11 0.65
12 0.64
13 0.56
14 0.51
15 0.43
16 0.36
17 0.32
18 0.3
19 0.32
20 0.3
21 0.3
22 0.28
23 0.28
24 0.27
25 0.25
26 0.25
27 0.17
28 0.14
29 0.16
30 0.21
31 0.25
32 0.34
33 0.43
34 0.51
35 0.6
36 0.63
37 0.71
38 0.72
39 0.76
40 0.76
41 0.7
42 0.66
43 0.64
44 0.6
45 0.54
46 0.47
47 0.41
48 0.32
49 0.28
50 0.22
51 0.14
52 0.13
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.06
65 0.06
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.12
76 0.12
77 0.14
78 0.18
79 0.21
80 0.2
81 0.22
82 0.22
83 0.24
84 0.26
85 0.26
86 0.25
87 0.28
88 0.33
89 0.35
90 0.34
91 0.29
92 0.27
93 0.25
94 0.22
95 0.2
96 0.15
97 0.17
98 0.22
99 0.24
100 0.25