Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165RKH7

Protein Details
Accession A0A165RKH7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-39LAPPRERPRGRSRNASRRNRRPRLLAPWPPHydrophilic
NLS Segment(s)
PositionSequence
10-33LAPPRERPRGRSRNASRRNRRPRL
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MSGREKVAPLAPPRERPRGRSRNASRRNRRPRLLAPWPPAKTSLPQSAPVPSDACPCTFGASLYPRCPPFEFDGLSAHSTLLYAPRIHRALSGRVDKSQRVSYFQTQDRYLLPSLLPLLVLPEVQPGRISTTYAGRIHRRAFLGVPSWSSATGVGRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.64
4 0.69
5 0.7
6 0.72
7 0.73
8 0.78
9 0.78
10 0.85
11 0.89
12 0.88
13 0.89
14 0.94
15 0.92
16 0.88
17 0.85
18 0.83
19 0.81
20 0.81
21 0.79
22 0.75
23 0.74
24 0.7
25 0.63
26 0.57
27 0.49
28 0.43
29 0.39
30 0.4
31 0.33
32 0.33
33 0.33
34 0.34
35 0.33
36 0.31
37 0.26
38 0.19
39 0.21
40 0.19
41 0.18
42 0.16
43 0.15
44 0.16
45 0.15
46 0.15
47 0.14
48 0.19
49 0.21
50 0.21
51 0.25
52 0.23
53 0.25
54 0.26
55 0.25
56 0.23
57 0.24
58 0.23
59 0.2
60 0.21
61 0.2
62 0.2
63 0.18
64 0.13
65 0.1
66 0.09
67 0.08
68 0.07
69 0.07
70 0.08
71 0.08
72 0.13
73 0.14
74 0.14
75 0.17
76 0.18
77 0.21
78 0.26
79 0.32
80 0.29
81 0.33
82 0.35
83 0.33
84 0.35
85 0.37
86 0.31
87 0.3
88 0.33
89 0.35
90 0.4
91 0.43
92 0.43
93 0.37
94 0.38
95 0.34
96 0.33
97 0.27
98 0.21
99 0.16
100 0.14
101 0.14
102 0.12
103 0.11
104 0.07
105 0.09
106 0.08
107 0.08
108 0.07
109 0.12
110 0.12
111 0.12
112 0.13
113 0.12
114 0.17
115 0.18
116 0.19
117 0.15
118 0.2
119 0.26
120 0.29
121 0.34
122 0.35
123 0.4
124 0.42
125 0.45
126 0.42
127 0.39
128 0.37
129 0.35
130 0.35
131 0.31
132 0.3
133 0.27
134 0.26
135 0.24
136 0.23
137 0.2
138 0.18