Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165SVH3

Protein Details
Accession A0A165SVH3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-144SVIKKKAKLSKAEQRHQRKCHYFRPFRDASHydrophilic
NLS Segment(s)
PositionSequence
118-125KKKAKLSK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MAEDEDIGLEALQAQVDMSMAFTQSLVSSWLKPTEGKLPSSKARGNQEKELEEYMKRPPRLGVGAAISESTSLLSRDSARLKSKLSASAGKKRTREEDVPVDTLLSDDEEESKASVIKKKAKLSKAEQRHQRKCHYFRPFRDASPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.09
14 0.1
15 0.11
16 0.13
17 0.15
18 0.16
19 0.16
20 0.18
21 0.24
22 0.25
23 0.27
24 0.29
25 0.33
26 0.36
27 0.42
28 0.43
29 0.4
30 0.47
31 0.53
32 0.54
33 0.55
34 0.55
35 0.51
36 0.5
37 0.47
38 0.39
39 0.3
40 0.27
41 0.29
42 0.31
43 0.3
44 0.28
45 0.26
46 0.27
47 0.28
48 0.27
49 0.21
50 0.15
51 0.15
52 0.15
53 0.14
54 0.1
55 0.08
56 0.07
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.09
64 0.12
65 0.16
66 0.19
67 0.21
68 0.22
69 0.25
70 0.26
71 0.27
72 0.28
73 0.31
74 0.33
75 0.41
76 0.46
77 0.49
78 0.5
79 0.49
80 0.5
81 0.49
82 0.47
83 0.44
84 0.45
85 0.44
86 0.43
87 0.39
88 0.34
89 0.28
90 0.24
91 0.18
92 0.11
93 0.07
94 0.05
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.1
101 0.13
102 0.18
103 0.24
104 0.33
105 0.39
106 0.48
107 0.56
108 0.61
109 0.66
110 0.7
111 0.73
112 0.75
113 0.77
114 0.79
115 0.82
116 0.85
117 0.85
118 0.86
119 0.86
120 0.83
121 0.84
122 0.85
123 0.84
124 0.81
125 0.82
126 0.76