Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165LKP0

Protein Details
Accession A0A165LKP0   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-53FIEGVRRSKHRRRLSCSRPNHSPQHCRHRKTBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MVITPDRQLLDNAPTIAYVIGLFIEGVRRSKHRRRLSCSRPNHSPQHCRHRKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.12
5 0.08
6 0.05
7 0.04
8 0.04
9 0.04
10 0.03
11 0.06
12 0.06
13 0.08
14 0.09
15 0.14
16 0.21
17 0.3
18 0.4
19 0.48
20 0.57
21 0.64
22 0.74
23 0.8
24 0.83
25 0.85
26 0.82
27 0.81
28 0.79
29 0.8
30 0.78
31 0.78
32 0.77
33 0.79
34 0.81