Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165TZJ4

Protein Details
Accession A0A165TZJ4   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-57GHLFRQCPERDKKRKENPKRRQPRITQSKALBasic
NLS Segment(s)
PositionSequence
37-50DKKRKENPKRRQPR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MDIDAMAPKERQRHQELGLCFYCHKQGHLFRQCPERDKKRKENPKRRQPRITQSKALYIPLTVRGVHKDIDIEALIDSSVMATYIRPRLVIKLRLSTTPLARPIPVFNVDDTPNKKGTITHSVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.53
4 0.53
5 0.5
6 0.44
7 0.38
8 0.34
9 0.36
10 0.29
11 0.29
12 0.29
13 0.34
14 0.43
15 0.52
16 0.55
17 0.52
18 0.6
19 0.62
20 0.62
21 0.64
22 0.64
23 0.65
24 0.7
25 0.77
26 0.79
27 0.87
28 0.91
29 0.92
30 0.92
31 0.93
32 0.94
33 0.92
34 0.91
35 0.88
36 0.88
37 0.87
38 0.83
39 0.79
40 0.69
41 0.66
42 0.58
43 0.5
44 0.39
45 0.29
46 0.23
47 0.18
48 0.18
49 0.12
50 0.12
51 0.12
52 0.13
53 0.14
54 0.13
55 0.1
56 0.09
57 0.11
58 0.1
59 0.08
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.07
71 0.1
72 0.11
73 0.12
74 0.12
75 0.19
76 0.26
77 0.33
78 0.33
79 0.38
80 0.39
81 0.4
82 0.43
83 0.4
84 0.37
85 0.35
86 0.36
87 0.3
88 0.29
89 0.29
90 0.29
91 0.29
92 0.29
93 0.25
94 0.22
95 0.24
96 0.26
97 0.33
98 0.34
99 0.34
100 0.33
101 0.32
102 0.31
103 0.3
104 0.33
105 0.35